HHsearch results for GI: 254781108 and protein with PDBid: 1shu_X

>1shu_X Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} SCOP: c.62.1.1 PDB: 1tzn_a 1sht_X 1t6b_Y*
Probab=99.76  E-value=2e-17  Score=121.60  Aligned_cols=174  Identities=20%  Similarity=0.263  Sum_probs=127.8

Q ss_pred             CCCCCEEEECCCCCCCCCCCCCCCCHHHHHCCCEECCCCCCCCEEEECCCCCCEEECCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             65431357505566666676663101233102301268876540310134322011255533341000245665541022
Q gi|254781108|r  146 LAISICMVLDVSRSMEDLYLQKHNDNNNMTSNKYLLPPPPKKSFWSKNTTKSKYAPAPAPANRKIDVLIESAGNLVNSIQ  225 (398)
Q Consensus       146 ~~~di~lvlD~SgSm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~  225 (398)
                      .++|+++++|.|+||...+                                              ...+..+..++..+.
T Consensus         5 ~~~DivfliD~S~Sm~~~~----------------------------------------------~~~k~~~~~~~~~~~   38 (182)
T 1shu_X            5 RAFDLYFVLDKSGSVANNW----------------------------------------------IEIYNFVQQLAERFV   38 (182)
T ss_dssp             SCEEEEEEEECSGGGGGGH----------------------------------------------HHHHHHHHHHHHHCC
T ss_pred             CCEEEEEEEECCCCCCCCH----------------------------------------------HHHHHHHHHHHHHHC
T ss_conf             9746999993897843279----------------------------------------------999999999999735


Q ss_pred             HCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHH---HCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             02768776521346541267765431123568999999997---357788874458899999996113466666566766
Q gi|254781108|r  226 KAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRL---NKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGST  302 (398)
Q Consensus       226 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lt~~~~~~~~~I---~~l~~~G~T~~~~gl~~a~~~l~~~~~~~~~~~~~~  302 (398)
                             ....+.+.+.|++..  ....+++++...+...+   ..+.+.|+|+++.++..+.+.+.....        .
T Consensus        39 -------~~~~rvglv~fs~~~--~~~~~~~~~~~~~~~~l~~~~~~~~~g~T~~~~al~~~~~~~~~~~~--------~  101 (182)
T 1shu_X           39 -------SPEMRLSFIVFSSQA--TIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGG--------L  101 (182)
T ss_dssp             -------CTTEEEEEEEESSSE--EEEEEEECCHHHHHHHHHHHHTCCCCSCCCHHHHHHHHHHHHHHHTG--------G
T ss_pred             -------CCCCEEEEEEECCCC--EEECCCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCC--------C
T ss_conf             -------899879999960454--15246435578899988877406799984699999999999875036--------7


Q ss_pred             CCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCCHHHHHHHHHCCCCCEEEECC-HHHHHHHHH
Q ss_conf             6651699815887787777766314899999999789889999954797558999998519981899469-899999999
Q gi|254781108|r  303 RLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRKCTDSSGQFFAVND-SRELLESFD  381 (398)
Q Consensus       303 ~~~k~iillTDG~~~~~~~~~~~~~~~~~c~~~K~~gi~IytIg~~~~~~~~~~l~~cAs~~~~yy~a~~-~~~L~~aF~  381 (398)
                      ...|++|+||||..+..    ........++.+|+.||.||+||++ + .+...|+.+|++|++.|.+.+ .++|.+.++
T Consensus       102 ~~~~~ivllTDG~~~~~----~~~~~~~~a~~l~~~gv~v~~Vgig-~-~~~~~L~~ia~~~~~~~~~~~~~~~L~~~~~  175 (182)
T 1shu_X          102 KTSSIIIALTDGKLDGL----VPSYAEKEAKISRSLGASVYCVGVL-D-FEQAQLERIADSKEQVFPVKGGFQALKGIIN  175 (182)
T ss_dssp             GSCEEEEEEECCCCCTT----HHHHHHHHHHHHHHTTCEEEEEECS-S-CCHHHHHHHSSSGGGEEESSSTTHHHHHHHH
T ss_pred             CCCEEEEEEECCCCCCC----CCHHHHHHHHHHHHCCCEEEEEEEC-C-CCHHHHHHHHCCCCCEEEECCCHHHHHHHHH
T ss_conf             88559999972887888----6489999999999789999999847-5-4899999985899966993499999999999


Q ss_pred             HHHHHHH
Q ss_conf             9999875
Q gi|254781108|r  382 KITDKIQ  388 (398)
Q Consensus       382 ~I~~~i~  388 (398)
                      +|.++|.
T Consensus       176 ~i~~~~C  182 (182)
T 1shu_X          176 SILAQSC  182 (182)
T ss_dssp             HHHHTBC
T ss_pred             HHHHHHC
T ss_conf             9986239