PSIBLAST alignment of GI: 254781108 and protein with PDB id: 1jlm

>gi|157831557|pdb|1JLM|A Chain A, I-Domain From Integrin Cr3, Mn2+ Bound Length = 192
 Score = 60.7 bits (145), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 23/120 (19%), Positives = 41/120 (34%), Gaps = 15/120 (12%)

Query: 273 ENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQIC 332
             T+T   +    REL+N    +          K ++ ITDGE      + + L    + 
Sbjct: 81  GRTHTATGIRKVVRELFNITNGAR-----KNAFKILVVITDGE-----KFGDPLGYEDVI 130

Query: 333 EYMRNAGMKIYSVAVSA---PPEGQDLLRKCTDSS--GQFFAVNDSRELLESFDKITDKI 387
                 G+  Y + V       + +  L            F VN+   L    +++ +KI
Sbjct: 131 PEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKI 190