PSIBLAST alignment of GI: 254781108 and protein with PDB id: 2win

>gi|239781743|pdb|2WIN|I Chain I, C3 Convertase (C3bbb) Stabilized By Scin Length = 507
>gi|239781744|pdb|2WIN|J Chain J, C3 Convertase (C3bbb) Stabilized By Scin Length = 507
>gi|239781745|pdb|2WIN|K Chain K, C3 Convertase (C3bbb) Stabilized By Scin Length = 507
>gi|239781746|pdb|2WIN|L Chain L, C3 Convertase (C3bbb) Stabilized By Scin Length = 507
 Score = 53.4 bits (126), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 34/211 (16%), Positives = 69/211 (32%), Gaps = 31/211 (14%)

Query: 202 APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNE 261
           + +          +   NL+  +     + +   V   T       V       S+N + 
Sbjct: 19  SDSIGASNFTGAKKCLVNLIEKVASYGVKPRYGLVTYATYPKIWVKVSEAD---SSNADW 75

Query: 262 VKSRLNKLNP-----YENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGEN 316
           V  +LN++N         TNT  A+   Y  +    +         R +  +I +TDG +
Sbjct: 76  VTKQLNEINYEDHKLKSGTNTKKALQAVYSMMSWPDDVPPEGWN--RTRHVIILMTDGLH 133

Query: 317 SGASAYQNTLNTLQICEYMRN-------------AGMKIYSVAVS--APPEGQDLLRKCT 361
           +         + + + + +R+               + +Y   V         + L    
Sbjct: 134 NMGG------DPITVIDEIRDLLYIGKDRKNPREDYLDVYVFGVGPLVNQVNINALASKK 187

Query: 362 DSSGQFFAVNDSRELLESFDKITDKIQEQSV 392
           D+    F V D   L + F ++ D+ Q  S+
Sbjct: 188 DNEQHVFKVKDMENLEDVFYQMIDESQSLSL 218