RPSBLAST alignment of GI: 254781108 and MMDB domain: 2ww8_A_221-279_318-447_506-585

>2ww8_A (A:221-279,A:318-447,A:506-585) RRGA, cell WALL surface anchor family protein; IGG, pilus, CNA_B, adhesin, integrin, cell adhesion; HET: EPE; 1.90A {Streptococcus pneumoniae}Length = 269
 Score = 42.6 bits (99), Expect = 9e-05
 Identities = 24/218 (11%), Positives = 57/218 (26%), Gaps = 44/218 (20%)

Query: 202 APAPANRKIDVLIESAGNLVNSIQKAIQEKKNLSVRIGTIAYN------------IGIVG 249
                 R+ +   E+  +L++ I        +   R+  + Y                  
Sbjct: 20  IRNKNARRAERAGEATRSLIDKI------TSDSENRVALVTYASTIDYSYLKLTNDKNDI 73

Query: 250 NQCTPLSNNLNEVKSRLNKLNPYENTNTYPAMHHAYRELYNEKESSHNTIGSTRLKKFVI 309
            +         E       +  +  T T  A+  A   L  +   +         +K + 
Sbjct: 74  VELKNKVPTEAEDHDGNRLMYQFGATFTQKALMKADEILTQQARQNS--------QKVIF 125

Query: 310 FITDGENSGASAYQNTLNTLQICEYMRNAGMKIYSVAVSAPPEGQDLLRK---------C 360
            ITDG  + +              +  +   ++ +    +P +   LL            
Sbjct: 126 HITDGVPTMSYPINF-----NHATFAPSYQNQLNAFFSKSPNKDGILLSDFITQATSGEH 180

Query: 361 TDSSGQFFAVNDSRELLESFDKIT----DKIQEQSVRI 394
           T   G   + +++ ++    D         I      +
Sbjct: 181 TIVRGDGQSNSNTAKITNHGDPTRWYYNGNIAPDGYDV 218