RPSBLAST alignment of GI: 254781108 and SCOP domain: d1n3ya_

Alignment
>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 189
 Score = 36.9 bits (84), Expect = 0.003
 Identities = 28/172 (16%), Positives = 65/172 (37%), Gaps = 16/172 (9%)

Query: 222 NSIQKAIQEKKNLSVRIGTIAYNIGIVGNQCTPLSNNLNEVKSRLNKLNPYENTN-TYPA 280
           N ++  I + +  S +   + ++     +         +   S L  ++  +    T  A
Sbjct: 25  NFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATA 84

Query: 281 MHHAYRELYNEKESSHNTIGSTRLKKFVIFITDGENSGASAYQNTLNTLQICEYMRNAGM 340
           + +    L++    +          K +I ITDG+  G     ++L+   +      AG+
Sbjct: 85  IQNVVHRLFHASYGARRDA-----AKILIVITDGKKEG-----DSLDYKDVIPMADAAGI 134

Query: 341 KIYSVAVSAPPEGQDLLRKCTD-----SSGQFFAVNDSRELLESFDKITDKI 387
             Y++ V    + ++  ++  D     S    F V D   L +  +++ +KI
Sbjct: 135 IRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKI 186

SCOP domain information

class: Alpha and beta proteins (a/b)
fold: vWA-like
superfamily: vWA-like
family: Integrin A (or I) domain
domain: Integrin alpha-x beta2
species: Human (Homo sapiens) [TaxId: 9606]