RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781109|ref|YP_003065522.1| hypothetical protein CLIBASIA_05055 [Candidatus Liberibacter asiaticus str. psy62] (86 letters) >gnl|CDD|117033 pfam08456, Vmethyltransf_C, Viral methyltransferase C-terminal. This domain is found to the C-terminus of the viral methyltransferase domain (pfam01660). Length = 360 Score = 25.8 bits (57), Expect = 2.4 Identities = 9/28 (32%), Positives = 17/28 (60%) Query: 14 RNIVIFISFIDSIILWCQHSRHVDFVID 41 R++ +++ D I LW QH+ + F +D Sbjct: 57 RDVPLYVEITDRIKLWKQHAPNNGFSLD 84 >gnl|CDD|132676 TIGR03637, cas1_YPEST, CRISPR-associated endonuclease Cas1, YPEST subtype. The CRISPR-associated protein Cas1 is virtually universal to CRISPR systems. CRISPR, an acronym for Clustered Regularly Interspaced Short Palindromic Repeats, is prokaryotic immunity system for foreign DNA, mostly from phage. CRISPR systems belong to different subtypes, distinguished by both nature of the repeats, the makeup of the cohort of associated Cas proteins, and by molecular phylogeny within the more universal Cas proteins such as this one. This model is of type EXCEPTION and provides more specific information than the EQUIVALOG model TIGR00287. It describes the Cas1 protein particular to the YPEST subtype of CRISPR/Cas system. Length = 307 Score = 24.7 bits (54), Expect = 5.2 Identities = 9/28 (32%), Positives = 15/28 (53%) Query: 21 SFIDSIILWCQHSRHVDFVIDSLMNLAL 48 F I Q S +D++I+S+ +AL Sbjct: 280 EFRQQCIAILQDSDALDYMIESIKEIAL 307 >gnl|CDD|132274 TIGR03230, lipo_lipase, lipoprotein lipase. Members of this protein family are lipoprotein lipase (EC 3.1.1.34), a eukaryotic triacylglycerol lipase active in plasma and similar to pancreatic and hepatic triacylglycerol lipases (EC 3.1.1.3). It is also called clearing factor. It cleaves chylomicron and VLDL triacylglycerols; it also has phospholipase A-1 activity. Length = 442 Score = 24.5 bits (53), Expect = 5.8 Identities = 8/16 (50%), Positives = 10/16 (62%) Query: 30 CQHSRHVDFVIDSLMN 45 C H R + IDSL+N Sbjct: 234 CSHERSIHLFIDSLLN 249 >gnl|CDD|184473 PRK14041, PRK14041, oxaloacetate decarboxylase; Provisional. Length = 467 Score = 24.4 bits (53), Expect = 6.4 Identities = 10/26 (38%), Positives = 19/26 (73%), Gaps = 1/26 (3%) Query: 3 LKNS-TKLLLRGRNIVIFISFIDSII 27 LKN+ ++LLRG+N+V + + D ++ Sbjct: 72 LKNTKIQMLLRGQNLVGYRHYADDVV 97 >gnl|CDD|182860 PRK10949, PRK10949, protease 4; Provisional. Length = 618 Score = 24.2 bits (53), Expect = 7.2 Identities = 10/34 (29%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Query: 22 FIDSIILWCQHSRHVDFVIDSLMNLALIMLIVLC 55 I W R ++FV + ++NL I LI++ Sbjct: 7 IIAGFFKWTW--RLLNFVRELVLNLFFIFLILVG 38 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.347 0.155 0.474 Gapped Lambda K H 0.267 0.0705 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,389,164 Number of extensions: 78887 Number of successful extensions: 543 Number of sequences better than 10.0: 1 Number of HSP's gapped: 539 Number of HSP's successfully gapped: 70 Length of query: 86 Length of database: 5,994,473 Length adjustment: 55 Effective length of query: 31 Effective length of database: 4,806,033 Effective search space: 148987023 Effective search space used: 148987023 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 14 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (21.7 bits) S2: 50 (23.1 bits)