RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781109|ref|YP_003065522.1| hypothetical protein CLIBASIA_05055 [Candidatus Liberibacter asiaticus str. psy62] (86 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 28.0 bits (62), Expect = 0.59 Identities = 13/83 (15%), Positives = 31/83 (37%), Gaps = 20/83 (24%) Query: 2 ILKNSTKLLLR-GRNIVIFISF----IDSIILWCQHSRH---VDFVIDSLMNLALIMLI- 52 ++K S + L R + ++ I+ W ++ + D+++ ++ LI +I Sbjct: 187 LIKFSAETLSELIRTTLDAEKVFTQGLN-ILEWLENPSNTPDKDYLLSIPISCPLIGVIQ 245 Query: 53 -----VLCR-----PVSHRRFFA 65 V + P R + Sbjct: 246 LAHYVVTAKLLGFTPGELRSYLK 268 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.347 0.155 0.474 Gapped Lambda K H 0.267 0.0550 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 709,497 Number of extensions: 25649 Number of successful extensions: 196 Number of sequences better than 10.0: 1 Number of HSP's gapped: 194 Number of HSP's successfully gapped: 14 Length of query: 86 Length of database: 5,693,230 Length adjustment: 54 Effective length of query: 32 Effective length of database: 4,384,054 Effective search space: 140289728 Effective search space used: 140289728 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 14 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (21.7 bits) S2: 50 (23.4 bits)