RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781110|ref|YP_003065523.1| von Willebrand factor type A [Candidatus Liberibacter asiaticus str. psy62] (420 letters) >gnl|CDD|29222 cd00198, vWFA, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains.. Length = 161 Score = 42.6 bits (99), Expect = 2e-04 Identities = 36/201 (17%), Positives = 69/201 (34%), Gaps = 46/201 (22%) Query: 193 IELVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDV 252 I ++D+SGSM K+ K AL + S+ Sbjct: 3 IVFLLDVSGSM--------------------GGEKLDKAKEALKALVSSLSASP---PGD 39 Query: 253 YMGLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDSLILKP---TDSTPAMKQAYQILTSDK 309 +GL+ + + + T+ + + +D+L T+ A++ A ++L S K Sbjct: 40 RVGLVTFGSNAR--VVLPLTTDTDKADLLEAIDALKKGLGGGTNIGAALRLALELLKSAK 97 Query: 310 KRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIKICDKAKENFIKIVTISI 369 + + ++ II LTDGE N+ + + ++ I + TI I Sbjct: 98 RPNA----------------RRVIILLTDGEPNDGPELLAEAA--RELRKLGITVYTIGI 139 Query: 370 NASPNGQRLLKTCVSSPEYHY 390 N L + + Sbjct: 140 GDDANEDELKEIADKTTGGAV 160 >gnl|CDD|31433 COG1240, ChlD, Mg-chelatase subunit ChlD [Coenzyme metabolism]. Length = 261 Score = 39.5 bits (92), Expect = 0.002 Identities = 54/244 (22%), Positives = 88/244 (36%), Gaps = 65/244 (26%) Query: 174 VSFIPALLRIEMGE-RPIFLIELVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALK 232 V+ P LR ++ E R LI VVD SGSM R +MAA K Sbjct: 61 VAIEPEDLREKIREGRAGNLIVFVVDASGSM-------------------AARRRMAAAK 101 Query: 233 NALLLFLDSIDLLSHVKEDVY-----MGLIGYT-TRVEKNIEPSWGTEKVRQYVTRDMDS 286 A L L D Y + +I + + E + P+ E + + R Sbjct: 102 GAALSLL----------RDAYQRRDKVAVIAFRGEKAELLLPPTSSVELAERALER---- 147 Query: 287 LILKPTDSTP---AMKQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNN 343 L TP A++QAY++L R+ + P + ++ +TDG N Sbjct: 148 --LPTGGKTPLADALRQAYEVLA------------REKRRGPDR--RPVMVVITDGRANV 191 Query: 344 FKSN---VNTIKICDKAKENFIKIVTISINASPNGQRLLKTCVS---SPEYHYNVVNADS 397 T++ K + I+++ I S L + YH + ++ DS Sbjct: 192 PIPLGPKAETLEAASKLRLRGIQLLVIDTEGSEVRLGLAEEIARASGGEYYHLDDLSDDS 251 Query: 398 LIHV 401 ++ Sbjct: 252 IVSA 255 >gnl|CDD|143873 pfam00092, VWA, von Willebrand factor type A domain. Length = 177 Score = 37.0 bits (86), Expect = 0.010 Identities = 35/215 (16%), Positives = 75/215 (34%), Gaps = 45/215 (20%) Query: 195 LVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYM 254 ++D SGS+ + K + ++++D+ + + Sbjct: 4 FLLDGSGSI------GEANFEKV--------------KEFIKKLVENLDIG---PDGTRV 40 Query: 255 GLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDSLILKPTDSTP---AMKQAYQILTSDKKR 311 GL+ Y++ V E S K + + + I T A+K A + L Sbjct: 41 GLVQYSSDV--TTEFSLNDYKSKDDLLSAVLRNIYYLGGGTNTGKALKYALENL------ 92 Query: 312 SFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIKICDKAKENFIKIVTISI-N 370 F + R K +I LTDG++N+ ++ I + + + + Sbjct: 93 -FRSAGSRPNAP-------KVVILLTDGKSNDGGLVPAAAAAL--RRKVGIIVFGVGVGD 142 Query: 371 ASPNGQRLLKTCVSSPEYHYNVVNADSLIHVFQNI 405 RL+ + S + + V + D+L + + + Sbjct: 143 VDEEELRLIASEPCSEGHVFYVTDFDALSDIQEEL 177 >gnl|CDD|29240 cd01467, vWA_BatA_type, VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses. In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains. Members of this subgroup are bacterial in origin. They are typified by the presence of a MIDAS motif.. Length = 180 Score = 34.1 bits (78), Expect = 0.074 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Query: 325 PSLPFQKFIIFLTDGENNNFKSNVNTIKICDKAKENFIKIVTISINAS 372 S ++ I+ LTDGENN ++ + AK ++I TI + S Sbjct: 98 NSEAKERVIVLLTDGENN--AGEIDPATAAELAKNKGVRIYTIGVGKS 143 >gnl|CDD|29229 cd01456, vWA_ywmD_type, VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains. Not much is known about the function of the members of this subgroup. All members of this subgroup however have a conserved MIDAS motif. . Length = 206 Score = 32.7 bits (74), Expect = 0.20 Identities = 33/201 (16%), Positives = 58/201 (28%), Gaps = 57/201 (28%) Query: 195 LVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYM 254 +V+D SGSM T++ K AL +++ + + + Sbjct: 25 IVLDNSGSMREV----DGG----------GETRLDNAKAALDETANALPDGTRLGLWTFS 70 Query: 255 GLIGYTTRVEKN------IEPSWGTEKVRQYVTRDMDSLILKPTDSTP---AMKQAYQIL 305 G V P G ++ + + PT TP A+ +A + Sbjct: 71 GDGDNPLDVRVLVPKGCLTAPVNGFPSAQRSALDAALNSLQTPTGWTPLAAALAEAAAYV 130 Query: 306 TSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIKICDKAKE------ 359 D R ++ +TDGE+ C+ A+E Sbjct: 131 --DPGRV------------------NVVVLITDGEDT------CGPDPCEVARELAKRRT 164 Query: 360 --NFIKIVTISINASPNGQRL 378 IK+ I + L Sbjct: 165 PAPPIKVNVIDFGGDADRAEL 185 >gnl|CDD|29224 cd01451, vWA_Magnesium_chelatase, Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto). In chlorophyll biosynthesis, insertion of Mg2+ into protoporphyrin IX is catalysed by magnesium chelatase in an ATP-dependent reaction. Magnesium chelatase is a three sub-unit (BchI, BchD and BchH) enzyme with a novel arrangement of domains: the C-terminal helical domain is located behind the nucleotide binding site. The BchD domain contains a AAA domain at its N-terminus and a VWA domain at its C-terminus. The VWA domain has been speculated to be involved in mediating protein-protein interactions.. Length = 178 Score = 31.7 bits (72), Expect = 0.37 Identities = 34/155 (21%), Positives = 53/155 (34%), Gaps = 49/155 (31%) Query: 192 LIELVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKED 251 L+ VVD SGSM R +MAA K A+L L ++ + D Sbjct: 2 LVIFVVDASGSM-------------------AARHRMAAAKGAVLSLLRD----AYQRRD 38 Query: 252 VYMGLIG-YTTRVEKNIEPSWGTEKVRQYVTRDMDSLILKPTDSTP---AMKQAYQILTS 307 + LI T E + P+ E ++ + R L TP + AY++ Sbjct: 39 -KVALIAFRGTEAEVLLPPTRSVELAKRRLAR------LPTGGGTPLAAGLLAAYELAAE 91 Query: 308 DKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENN 342 + + I+ +TDG N Sbjct: 92 QARD---------------PGQRPLIVVITDGRAN 111 >gnl|CDD|34193 COG4548, NorD, Nitric oxide reductase activation protein [Inorganic ion transport and metabolism]. Length = 637 Score = 30.7 bits (69), Expect = 0.80 Identities = 33/156 (21%), Positives = 52/156 (33%), Gaps = 45/156 (28%) Query: 195 LVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYM 254 L+VD+S S M D+ R + ALL+ L ED+ Sbjct: 451 LLVDVSASTDAKM--------------DETRRVIDLFHEALLVLAHGHQALGD-SEDIL- 494 Query: 255 GLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDS---LILKPTDST---PAMKQAYQILTSD 308 +T+R + T K + + L+P T A++ A L Sbjct: 495 ---DFTSRRRPWVR--INTVKDFDESMGETVGPRIMALEPGYYTRDGAAIRHASAKLMER 549 Query: 309 KKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNF 344 +R QK +I L+DG+ N+F Sbjct: 550 PQR------------------QKLLIVLSDGKPNDF 567 >gnl|CDD|29234 cd01461, vWA_interalpha_trypsin_inhibitor, vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin). Bikunin confers the protease-inhibitor function while the heavy chains are involved in rendering stability to the extracellular matrix by binding to hyaluronic acid. The heavy chains carry the VWA domain with a conserved MIDAS motif. Although the exact role of the VWA domains remains unknown, it has been speculated to be involved in mediating protein-protein interactions with the components of the extracellular matrix.. Length = 171 Score = 30.1 bits (68), Expect = 1.1 Identities = 40/182 (21%), Positives = 59/182 (32%), Gaps = 49/182 (26%) Query: 195 LVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYM 254 V+D SGSM TK+ K ALL L + Y Sbjct: 7 FVIDTSGSM--------------------SGTKIEQTKEALLTALKDL------PPGDYF 40 Query: 255 GLIGYTTRVE--KNIEPSWGTEKVRQYVTRDMDSLILKPTDSTPAMKQAYQILTSDKKRS 312 +IG++ VE S E V + L T+ A++ A ++L S Sbjct: 41 NIIGFSDTVEEFSPSSVSATAENVAAAIEYVNRLQALGGTNMNDALEAALELLNSSPGSV 100 Query: 313 FFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIKICDKAKENFIKIVTISINAS 372 II LTDGE N + ++ +A I++ T I + Sbjct: 101 ------------------PQIILLTDGEVTNESQILKNVR---EALSGRIRLFTFGIGSD 139 Query: 373 PN 374 N Sbjct: 140 VN 141 >gnl|CDD|33614 COG3821, COG3821, Predicted membrane protein [Function unknown]. Length = 234 Score = 28.8 bits (64), Expect = 2.7 Identities = 19/72 (26%), Positives = 28/72 (38%), Gaps = 5/72 (6%) Query: 26 FALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAAILAGASKMVSNLSRLGDRFESISNH 85 F L V +L + + W S N +IL GA M ++ + + E + Sbjct: 111 FELKVGGLTVLFAYSFFKFGW-----SYRLFNYCSILIGAIPMWADNAVDAEAAERAAER 165 Query: 86 AKRALIDDAKRF 97 A R I AK F Sbjct: 166 AIRMNILAAKHF 177 >gnl|CDD|29238 cd01465, vWA_subgroup, VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains. Not much is known about the function of the VWA domain in these proteins. The members do have a conserved MIDAS motif. The biochemical function however is not known.. Length = 170 Score = 29.0 bits (65), Expect = 2.8 Identities = 37/213 (17%), Positives = 69/213 (32%), Gaps = 52/213 (24%) Query: 195 LVVDLSGSMHCAMNSDPEDVNSAPICQDKKRTKMAALKNALLLFLDSIDLLSHVKEDVYM 254 V+D SGSM K+ +K+AL L +D + D + Sbjct: 5 FVIDRSGSM--------------------DGPKLPLVKSALKLLVDQLR------PDDRL 38 Query: 255 GLIGYTTRVEKNIEPSWGTEKVRQYVTRDMDSLILKPTDSTP---AMKQAYQILTSDKKR 311 ++ Y E + + +K + +D L ST ++ YQ Sbjct: 39 AIVTYDGAAETVLPATPVRDKAA--ILAAIDR--LTAGGSTAGGAGIQLGYQEAQK---- 90 Query: 312 SFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNFKSNVNTIK--ICDKAKENFIKIVTISI 369 +F GV I+ TDG+ N +++ + + + K + I + T+ Sbjct: 91 ----HFVPGGV--------NRILLATDGDFNVGETDPDELARLVAQKRESG-ITLSTLGF 137 Query: 370 NASPNGQRLLKTCVSSPEYHYNVVNADSLIHVF 402 + N + + + N VF Sbjct: 138 GDNYNEDLMEAIADAGNGNTAYIDNLAEARKVF 170 >gnl|CDD|38865 KOG3661, KOG3661, KOG3661, Uncharacterized conserved protein [Function unknown]. Length = 1019 Score = 28.5 bits (63), Expect = 3.4 Identities = 14/36 (38%), Positives = 21/36 (58%) Query: 12 KKGIASEKANFSIIFALSVMSFLLLIGFLIYVLDWH 47 + I+S ++I + VM+F LL +YVLDWH Sbjct: 650 QACISSRFLQGTVIALVVVMAFCLLAMSALYVLDWH 685 >gnl|CDD|34592 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]. Length = 573 Score = 28.3 bits (63), Expect = 4.1 Identities = 18/86 (20%), Positives = 34/86 (39%), Gaps = 4/86 (4%) Query: 22 FSIIFALSVMSFLLLIGFLIYVLDWHYKKNSME--SANNAAILAGASKMVSNLSRLGDRF 79 FSI AL + LLL+ +I L + + + AA+ + + V + L Sbjct: 156 FSIPLALLLGLILLLLLLIIPTLFYRAGRKFGAHLAQGRAALRSQFTDWVQGQAEL--LI 213 Query: 80 ESISNHAKRALIDDAKRFIKNHIKES 105 + + AL ++K K++ Sbjct: 214 FGAEDAYRTALEATEASWLKAQRKQA 239 >gnl|CDD|114542 pfam05820, DUF845, Baculovirus protein of unknown function (DUF845). This family consists of several highly related Baculovirus proteins of unknown function. Length = 119 Score = 28.4 bits (64), Expect = 4.4 Identities = 10/25 (40%), Positives = 16/25 (64%) Query: 330 QKFIIFLTDGENNNFKSNVNTIKIC 354 + I +L D + N+ +N+N IKIC Sbjct: 9 ELLIHYLFDNKTNDTSNNINVIKIC 33 >gnl|CDD|147288 pfam05028, PARG_cat, Poly (ADP-ribose) glycohydrolase (PARG). Poly(ADP-ribose) glycohydrolase (PARG), is a ubiquitously expressed exo- and endoglycohydrolase which mediates oxidative and excitotoxic neuronal death. Length = 339 Score = 27.3 bits (61), Expect = 7.8 Identities = 16/68 (23%), Positives = 25/68 (36%), Gaps = 7/68 (10%) Query: 288 ILKPTDSTPAM---KQAYQILTSDKKRSFFTNFFRQGVKIPSLPFQKFIIFLTDGENNNF 344 +LK D+ +Q +L + SFF F R+ + S P F N Sbjct: 38 LLKQQDAGSVTLSQEQIAALLAN----SFFCLFPRRNREESSFPDINFDRLFQSLYNGRS 93 Query: 345 KSNVNTIK 352 +S +K Sbjct: 94 ESQEEKLK 101 >gnl|CDD|34100 COG4393, COG4393, Predicted membrane protein [Function unknown]. Length = 405 Score = 27.2 bits (60), Expect = 9.6 Identities = 13/57 (22%), Positives = 27/57 (47%) Query: 19 KANFSIIFALSVMSFLLLIGFLIYVLDWHYKKNSMESANNAAILAGASKMVSNLSRL 75 K F + ++ +L I FL+++ K++ + NNA + + + +N RL Sbjct: 193 KFENKSTFYIYILFTILAIIFLLFLFKDSRKRHIVTQKNNAILKRKKAALKNNKHRL 249 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.135 0.383 Gapped Lambda K H 0.267 0.0740 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,830,627 Number of extensions: 253976 Number of successful extensions: 757 Number of sequences better than 10.0: 1 Number of HSP's gapped: 750 Number of HSP's successfully gapped: 40 Length of query: 420 Length of database: 6,263,737 Length adjustment: 96 Effective length of query: 324 Effective length of database: 4,189,273 Effective search space: 1357324452 Effective search space used: 1357324452 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 59 (26.5 bits)