RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781111|ref|YP_003065524.1| geranyltranstransferase protein [Candidatus Liberibacter asiaticus str. psy62] (237 letters) >gnl|CDD|144078 pfam00348, polyprenyl_synt, Polyprenyl synthetase. Length = 260 Score = 177 bits (451), Expect = 2e-45 Identities = 80/198 (40%), Positives = 117/198 (59%), Gaps = 7/198 (3%) Query: 39 LLSAIRYALL-GGKKIRSFLVTECASLFNVNHLTALRVGAAIECIHCYSLIHDDLPSMDN 97 LL+A+ Y LL GGK+IR LV A V T L + AIE IH SL+HDDL MDN Sbjct: 1 LLAAMLYYLLAGGKRIRPLLVVLAARALGVEPETLLYLACAIEMIHTASLVHDDL--MDN 58 Query: 98 GYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQ 157 +RRGKPT H ++ E AI+AG+ LL+ AF++++ ++ + L+ L + +G Q Sbjct: 59 SDLRRGKPTCHKKFGEAGAILAGDALLSRAFQLLAL-LGHVRPEPKYILISELANAVGAQ 117 Query: 158 GMLGGQMLDIQDEFIDETQV--FMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGE 215 G + GQ++D++ E D T I KT AL + + GAI+A A + +++ L FG Sbjct: 118 GEV-GQLMDLETEGKDITLEEYLRIVSYKTAALFYASVQLGAIVAGADEEDEKDLYDFGR 176 Query: 216 NLGIIFQLADDLLDCEED 233 +LG+ FQ+ DD+LD D Sbjct: 177 DLGLAFQIQDDILDLTGD 194 >gnl|CDD|173833 cd00685, Trans_IPPS_HT, Trans-Isoprenyl Diphosphate Synthases, head-to-tail. These trans-Isoprenyl Diphosphate Synthases (Trans_IPPS) catalyze head-to-tail (HT) (1'-4) condensation reactions. This CD includes all-trans (E)-isoprenyl diphosphate synthases which synthesize various chain length (C10, C15, C20, C25, C30, C35, C40, C45, and C50) linear isoprenyl diphosphates from precursors, isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP). They catalyze the successive 1'-4 condensation of the 5-carbon IPP to allylic substrates geranyl-, farnesyl-, or geranylgeranyl-diphosphate. Isoprenoid chain elongation reactions proceed via electrophilic alkylations in which a new carbon-carbon single bond is generated through interaction between a highly reactive electron-deficient allylic carbocation and an electron-rich carbon-carbon double bond. The catalytic site consists of a large central cavity formed by mostly antiparallel alpha helices with two aspartate-rich regions (DDXX(XX)D) located on opposite walls. These residues mediate binding of prenyl phosphates via bridging Mg2+ ions, inducing proposed conformational changes that close the active site to solvent, protecting and stabilizing reactive carbocation intermediates. Farnesyl diphosphate synthases produce the precursors of steroids, cholesterol, sesquiterpenes, farnsylated proteins, heme, and vitamin K12; and geranylgeranyl diphosphate and longer chain synthases produce the precursors of carotenoids, retinoids, diterpenes, geranylgeranylated chlorophylls, ubiquinone, and archaeal ether linked lipids. Isoprenyl diphosphate synthases are widely distributed among archaea, bacteria, and eukareya. Length = 259 Score = 173 bits (440), Expect = 5e-44 Identities = 80/205 (39%), Positives = 117/205 (57%), Gaps = 13/205 (6%) Query: 34 QHNDRLLSAIRYALL-GGKKIRSFLVTECASLFNVNHL-TALRVGAAIECIHCYSLIHDD 91 + L A+RY LL GGK++R LV A L ALR+ AAIE +H SL+HDD Sbjct: 1 SEVELLREALRYLLLAGGKRLRPLLVLLAARALGGPELEAALRLAAAIELLHTASLVHDD 60 Query: 92 LPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLT 151 + MDN +RRGKPTVH + TAI+AG+ LL AFE+++ +L + + + + Sbjct: 61 V--MDNSDLRRGKPTVHKVFGNATAILAGDYLLARAFELLA----RLGNPYYPRALELFS 114 Query: 152 HNIGLQGMLGGQMLDIQDEF---IDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKE 208 + ++ GQ+LD+ E+ + E + I ++KT AL A GA++A A + E E Sbjct: 115 E--AILELVEGQLLDLLSEYDTDVTEEEYLRIIRLKTAALFAAAPLLGALLAGADEEEAE 172 Query: 209 RLRCFGENLGIIFQLADDLLDCEED 233 L+ FG NLG+ FQ+ DD+LD D Sbjct: 173 ALKRFGRNLGLAFQIQDDILDLFGD 197 >gnl|CDD|30491 COG0142, IspA, Geranylgeranyl pyrophosphate synthase [Coenzyme metabolism]. Length = 322 Score = 171 bits (435), Expect = 1e-43 Identities = 90/236 (38%), Positives = 129/236 (54%), Gaps = 23/236 (9%) Query: 5 LPSKLQENSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYALL-GGKKIRSFLVTECAS 63 L + L + RI+ +L +LL + LL A+RY LL GGK++R LV A Sbjct: 3 LLALLLKRLARIEELLSELL-------SGSDPELLLEAMRYLLLAGGKRLRPLLVLLAAE 55 Query: 64 LFNVNHLT----ALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIA 119 ++ T AL + AAIE IH SLIHDDL MD+ +RRGKPTVH ++ E TAI+A Sbjct: 56 ALGIDLETGGNDALDLAAAIELIHTASLIHDDL--MDDDDLRRGKPTVHAKFGEATAILA 113 Query: 120 GNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDEF--IDETQV 177 G+ LL AFE++S ++ + I++ + G+ GGQ LD+ E + + Sbjct: 114 GDALLAAAFELLSKLGSEALEAIKAL-------AEAINGLCGGQALDLAFENKPVTLEEY 166 Query: 178 FMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEED 233 + ++KT AL A GAI+A A + E L +G NLG+ FQ+ DD+LD D Sbjct: 167 LRVIELKTAALFAAAAVLGAILAGADEELLEALEDYGRNLGLAFQIQDDILDITGD 222 >gnl|CDD|35995 KOG0776, KOG0776, KOG0776, Geranylgeranyl pyrophosphate synthase/Polyprenyl synthetase [Coenzyme transport and metabolism]. Length = 384 Score = 128 bits (322), Expect = 2e-30 Identities = 62/191 (32%), Positives = 103/191 (53%), Gaps = 4/191 (2%) Query: 41 SAIRYALL-GGKKIRSFLV-TECASLFNVNHLTALRVGAAIECIHCYSLIHDDLPSMDNG 98 A+RY LL GGK++R L C + + + + + +E IH SLIHDD+P MD+ Sbjct: 97 EAMRYLLLAGGKRVRPLLCLAACELVGSGDESSQRSLAEIVEMIHTASLIHDDVPCMDDA 156 Query: 99 YIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQG 158 +RRGKPT H + A++AG+ LL A E ++S + + + + + L QG Sbjct: 157 DLRRGKPTNHKVFGNKMAVLAGDALLALASEHLASLENPVVVELMASAIADLVRGEFTQG 216 Query: 159 MLGGQMLDIQDEFIDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLG 218 ++ G+ LD+ D ++ + +KT +L+ +C + AI+ S+ E +G LG Sbjct: 217 LVAGEGLDLDDVGLEYLE--FKTLLKTASLLAKSCVAAAILGGGSEEVIEAAFEYGRCLG 274 Query: 219 IIFQLADDLLD 229 + FQ+ DD+LD Sbjct: 275 LAFQVVDDILD 285 >gnl|CDD|173836 cd00867, Trans_IPPS, Trans-Isoprenyl Diphosphate Synthases. Trans-Isoprenyl Diphosphate Synthases (Trans_IPPS) of class 1 isoprenoid biosynthesis enzymes which either synthesis geranyl/farnesyl diphosphates (GPP/FPP) or longer chained products from isoprene precursors, isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), or use geranyl (C10)-, farnesyl (C15)-, or geranylgeranyl (C20)-diphosphate as substrate. These enzymes produce a myriad of precursors for such end products as steroids, cholesterol, sesquiterpenes, heme, carotenoids, retinoids, diterpenes, ubiquinone, and archaeal ether linked lipids; and are widely distributed among archaea, bacteria, and eukareya. The enzymes in this family share the same 'isoprenoid synthase fold' and include the head-to-tail (HT) IPPS which catalyze the successive 1'-4 condensation of the 5-carbon IPP to the growing isoprene chain to form linear, all-trans, C10-, C15-, C20- C25-, C30-, C35-, C40-, C45-, or C50-isoprenoid diphosphates. The head-to-head (HH) IPPS catalyze the successive 1'-1 condensation of 2 farnesyl or 2 geranylgeranyl isoprenoid diphosphates. Isoprenoid chain elongation reactions proceed via electrophilic alkylations in which a new carbon-carbon single bond is generated through interaction between a highly reactive electron-deficient allylic carbocation and an electron-rich carbon-carbon double bond. The catalytic site consists of a large central cavity formed by mostly antiparallel alpha helices with two aspartate-rich regions located on opposite walls. These residues mediate binding of prenyl phosphates via bridging Mg2+ ions, inducing proposed conformational changes that close the active site to solvent, stabilizing reactive carbocation intermediates. Mechanistically and structurally distinct, cis-IPPS are not included in this CD. Length = 236 Score = 125 bits (315), Expect = 1e-29 Identities = 60/185 (32%), Positives = 93/185 (50%), Gaps = 15/185 (8%) Query: 53 IRSFLVTECASLFNVNHLTALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVH-IQY 111 R LV A + ALR+ AA+E +H SL+HDD+ +D+ +RRGKPT H ++ Sbjct: 1 SRPLLVLLLARALGGDLEAALRLAAAVELLHAASLVHDDI--VDDSDLRRGKPTAHLRRF 58 Query: 112 DEVTAIIAGNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDEF 171 AI+AG+ LL AF++++ + ++ L+ +L GQ LD++ E Sbjct: 59 GNALAILAGDYLLARAFQLLARLGYPRALELFAE---------ALRELLEGQALDLEFER 109 Query: 172 ---IDETQVFMIQKMKTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLL 228 + + KT L+ C GA ++ A + E L+ +G LG+ FQL DDLL Sbjct: 110 DTYETLDEYLEYCRYKTAGLVGLLCLLGAGLSGADDEQAEALKDYGRALGLAFQLTDDLL 169 Query: 229 DCEED 233 D D Sbjct: 170 DVFGD 174 >gnl|CDD|164542 CHL00151, preA, prenyl transferase; Reviewed. Length = 323 Score = 97.6 bits (243), Expect = 2e-21 Identities = 58/229 (25%), Positives = 107/229 (46%), Gaps = 18/229 (7%) Query: 9 LQENSKRIDTILDDLLL--QTASHMQTQHNDRLLSAIRYAL-LGGKKIRSFLVTECASLF 65 + NS + I ++LL+ + + L +A ++ GGK+IR +V A Sbjct: 1 MATNSNLLTPIEEELLILEDNLKKLIGSGHPILYAAAKHLFSAGGKRIRPAIVLLVAKAT 60 Query: 66 NVNHLTAL---RVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNG 122 N R+ E IH SL+HDD+ +D IRRG PTVH + A++AG+ Sbjct: 61 GGNMEIKTSQQRLAEITEIIHTASLVHDDV--IDECSIRRGIPTVHKIFGTKIAVLAGDF 118 Query: 123 LLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDEFIDETQVFMIQK 182 L + +++ + S+++ QG++ D ++ I+K Sbjct: 119 LFAQSSWYLANLNNLEVVKLISKVITDFAEGEIRQGLV---QFDTTLSILN-----YIEK 170 Query: 183 M--KTGALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLD 229 KT +L+ +C++ A+++ A + + +G++LG+ FQ+ DD+LD Sbjct: 171 SFYKTASLIAASCKAAALLSDADEKDHNDFYLYGKHLGLAFQIIDDVLD 219 >gnl|CDD|173830 cd00385, Isoprenoid_Biosyn_C1, Isoprenoid Biosynthesis enzymes, Class 1. Superfamily of trans-isoprenyl diphosphate synthases (IPPS) and class I terpene cyclases which either synthesis geranyl/farnesyl diphosphates (GPP/FPP) or longer chained products from isoprene precursors, isopentenyl diphosphate (IPP) and dimethylallyl diphosphate (DMAPP), or use geranyl (C10)-, farnesyl (C15)-, or geranylgeranyl (C20)-diphosphate as substrate. These enzymes produce a myriad of precursors for such end products as steroids, cholesterol, sesquiterpenes, heme, carotenoids, retinoids, and diterpenes; and are widely distributed among archaea, bacteria, and eukaryota.The enzymes in this superfamily share the same 'isoprenoid synthase fold' and include several subgroups. The head-to-tail (HT) IPPS catalyze the successive 1'-4 condensation of the 5-carbon IPP to the growing isoprene chain to form linear, all-trans, C10-, C15-, C20- C25-, C30-, C35-, C40-, C45-, or C50-isoprenoid diphosphates. Cyclic monoterpenes, diterpenes, and sesquiterpenes, are formed from their respective linear isoprenoid diphosphates by class I terpene cyclases. The head-to-head (HH) IPPS catalyze the successive 1'-1 condensation of 2 farnesyl or 2 geranylgeranyl isoprenoid diphosphates. Cyclization of these 30- and 40-carbon linear forms are catalyzed by class II cyclases. Both the isoprenoid chain elongation reactions and the class I terpene cyclization reactions proceed via electrophilic alkylations in which a new carbon-carbon single bond is generated through interaction between a highly reactive electron-deficient allylic carbocation and an electron-rich carbon-carbon double bond. The catalytic site consists of a large central cavity formed by mostly antiparallel alpha helices with two aspartate-rich regions located on opposite walls. These residues mediate binding of prenyl phosphates via bridging Mg2+ ions, inducing proposed conformational changes that close the active site to solvent, stabilizing reactive carbocation intermediates. Generally, the enzymes in this family exhibit an all-trans reaction pathway, an exception, is the cis-trans terpene cyclase, trichodiene synthase. Mechanistically and structurally distinct, class II terpene cyclases and cis-IPPS are not included in this CD. Length = 243 Score = 95.3 bits (237), Expect = 1e-20 Identities = 56/168 (33%), Positives = 80/168 (47%), Gaps = 17/168 (10%) Query: 72 ALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQ---YDEVTAIIAGNGLLTYAF 128 A R+ AA+E +H SL+HDD+ +D+ RRG PT H+ AI+AG+ LL AF Sbjct: 12 ASRLRAAVEKLHAASLVHDDI--VDDSGTRRGLPTAHLAVAIDGLPEAILAGDLLLADAF 69 Query: 129 EIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQDEF---IDETQVFMIQKMKT 185 E ++ S L + L +L GQ+LD++ + + KT Sbjct: 70 EELA--------REGSPEALEILAEA-LLDLLEGQLLDLKWRREYVPTLEEYLEYCRYKT 120 Query: 186 GALMCFACESGAIMAHASQNEKERLRCFGENLGIIFQLADDLLDCEED 233 L+ C GA ++ E LR G LG+ FQL +DLLD E D Sbjct: 121 AGLVGALCLLGAGLSGGEAELLEALRKLGRALGLAFQLTNDLLDYEGD 168 >gnl|CDD|35930 KOG0711, KOG0711, KOG0711, Polyprenyl synthetase [Coenzyme transport and metabolism]. Length = 347 Score = 55.0 bits (132), Expect = 2e-08 Identities = 58/238 (24%), Positives = 97/238 (40%), Gaps = 26/238 (10%) Query: 9 LQENSKRIDTILDDLLLQTASHMQTQHNDRLLSAIRYALLGGKKIRSFLVTEC-ASLFNV 67 LQ + + +DL+ S T+ L + Y ++GGK R V + +L Sbjct: 13 LQVFPVLVRVLTEDLMAHGESGDATE---WLKEVLDYNVIGGKLNRGLSVVDSFKALVEP 69 Query: 68 NHLT------ALRVGAAIECIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEV--TAIIA 119 L AL +G +E + + L+ DD+ MDN RRG+P + Q V AI Sbjct: 70 RKLDEEELQLALILGWCVELLQAFFLVADDI--MDNSKTRRGQPCWY-QKPGVGLDAIND 126 Query: 120 GNGLLTYAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDIQD-----EFIDE 174 L ++++ + + ++ L H + Q LG + + +F E Sbjct: 127 AFLLEAAIYKLLKKHFRNIYCYVD---LVELFHEVTFQTELGDLLTTPEGNKDLSKFSLE 183 Query: 175 TQVFMIQKMKTGALMCFACESGAIMAHASQNEKE--RLRCFGENLGIIFQLADDLLDC 230 VF+++ KT + + A++ N KE + LG FQ+ DD LDC Sbjct: 184 KYVFIVEY-KTAYYSFYLPVALALLLAGIANLKEHACEKKVLLLLGEYFQVQDDYLDC 240 >gnl|CDD|35996 KOG0777, KOG0777, KOG0777, Geranylgeranyl pyrophosphate synthase/Polyprenyl synthetase [Coenzyme transport and metabolism]. Length = 322 Score = 52.8 bits (126), Expect = 9e-08 Identities = 61/214 (28%), Positives = 88/214 (41%), Gaps = 22/214 (10%) Query: 22 DLLLQTASHMQTQHNDRLLSAIRYAL-LGGKKIRSFLVTECASLFNVNHLTALRVGAAIE 80 D L+ Q+Q+ LL Y L GK+ R L+ N+ + +E Sbjct: 6 DELINNDPVTQSQNESILLKPYNYILQKPGKQFRLNLIVAFNHWLNLPKDKLAIISQIVE 65 Query: 81 CIHCYSLIHDDLPSMDNGYIRRGKPTVHIQYDEVTAIIAGNGLLTYAFEIISSPKTQLKD 140 +H SL+ DD+ DN +RRG+P H Y + I N + A E +S Sbjct: 66 MLHNSSLLIDDIE--DNSPLRRGQPVAHSIYGVPSTINTANYMYFLALEKVSQLDHPNAI 123 Query: 141 NIRSQLMLSLTHNIGLQGMLGGQMLDI--QDEFIDETQVFMIQKM---KTGALMCFACES 195 I ++ +L L GQ LDI +D T+ M + M KTG L A Sbjct: 124 KIFTEQLLELHR---------GQGLDIYWRDFLTCPTEE-MYKNMVMNKTGGLFRLALRL 173 Query: 196 GAIMAHASQNEKERLRCFGENLGIIFQLADDLLD 229 + +H KE L LG+IFQ+ DD L+ Sbjct: 174 MQLFSH----HKEDLVPLINLLGLIFQIRDDYLN 203 >gnl|CDD|173976 cd08211, RuBisCO_large_II, Ribulose bisphosphate carboxylase large chain, Form II. Ribulose bisphosphate carboxylase (Rubisco) plays an important role in the Calvin reductive pentose phosphate pathway. It catalyzes the primary CO2 fixation step. Rubisco is activated by carbamylation of an active site lysine, stabilized by a divalent cation, which then catalyzes the proton abstraction from the substrate ribulose 1,5 bisphosphate (RuBP) and leads to the formation of two molecules of 3-phosphoglycerate. Members of the Rubisco family can be divided into 4 subgroups, Form I-IV , which differ in their taxonomic distribution and subunit composition. Form II is mainly found in bacteria, and forms large subunit oligomers (dimers, tetramers, etc.) that do not include small subunits. Length = 439 Score = 27.9 bits (62), Expect = 2.9 Identities = 10/42 (23%), Positives = 18/42 (42%) Query: 126 YAFEIISSPKTQLKDNIRSQLMLSLTHNIGLQGMLGGQMLDI 167 Y E+ T + + S L L + +N G+ + +M D Sbjct: 84 YPVELFDRNLTDGRAMVASFLTLIIGNNQGMGDVEYLKMHDF 125 >gnl|CDD|173960 cd08550, GlyDH-like, Glycerol_dehydrogenase-like. Families of proteins related to glycerol dehydrogenases. Glycerol dehydrogenases (GlyDH) is a key enzyme in the glycerol dissimilation pathway. In anaerobic conditions, many microorganisms utilize glycerol as a source of carbon through coupled oxidative and reductive pathways. One of the pathways involves the oxidation of glycerol to dihydroxyacetone with the reduction of NAD+ to NADH catalyzed by glycerol dehydrogenases. Dihydroxyacetone is then phosphorylated by dihydroxyacetone kinase and enters the glycolytic pathway for further degradation. The activity of GlyDH is zinc-dependent. The zinc ion plays a role in stabilizing an alkoxide intermediate at the active site. Some subfamilies have not been characterized till now. Length = 349 Score = 27.5 bits (61), Expect = 3.1 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Query: 203 SQNEKERLRCFGENLGIIFQLAD-DLLDCEEDLPK 236 + E E L F LG+ LAD L +ED+ K Sbjct: 284 PREEIEELVEFYRQLGLPVTLADLGLEFSDEDIKK 318 >gnl|CDD|112354 pfam03531, SSrecog, Structure-specific recognition protein (SSRP1). SSRP1 has been implicated in transcriptional initiation and elongation and in DNA replication and repair. Length = 216 Score = 27.4 bits (61), Expect = 3.6 Identities = 10/44 (22%), Positives = 25/44 (56%), Gaps = 6/44 (13%) Query: 76 GAAIECIHCYSLIHDD--LPSMDNGYIRRGKPTVHIQYDEVTAI 117 AA++C S ++ L ++ G+ KP + I+++E++++ Sbjct: 130 TAAVKC----SYKANEGLLYPLEKGFFFLPKPPLLIRFEEISSV 169 >gnl|CDD|107293 cd06298, PBP1_CcpA_like, Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation. Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation (CCR), a process in which enzymes necessary for the metabolism of alternative sugars are inhibited in the presence of glucose. In gram-positive bacteria, CCR is controlled by HPr, a phosphoenolpyruvate:sugar phsophotrasnferase system (PTS) and a transcriptional regulator CcpA. Moreover, CcpA can regulate sporulation and antibiotic resistance as well as play a role in virulence development of certain pathogens such as the group A streptococcus. The ligand binding domain of CcpA is a member of the LacI-GalR family of bacterial transcription regulators. Length = 268 Score = 26.8 bits (60), Expect = 4.7 Identities = 28/111 (25%), Positives = 41/111 (36%), Gaps = 33/111 (29%) Query: 96 DNGYIRRGKPTVHIQYD---------EVTAIIAGN-----GLLTYA----------FEII 131 D I G T Y+ + TA + G+L A FEII Sbjct: 151 DESLIFEGDYTYESGYELAEELLEDGKPTAAFVTDDELAIGILNAAQDAGLKVPEDFEII 210 Query: 132 SSPKTQLKDNIRSQLMLSLTH---NIGLQGMLGGQMLD--IQDEFIDETQV 177 T+L +R QL S+T +IG M ++L + E ++ QV Sbjct: 211 GFNNTKLASMVRPQLT-SVTQPLYDIGAVAM---RLLTKLMNKEEVENKQV 257 >gnl|CDD|35746 KOG0526, KOG0526, KOG0526, Nucleosome-binding factor SPN, POB3 subunit [Transcription, Replication, recombination and repair, Chromatin structure and dynamics]. Length = 615 Score = 26.1 bits (57), Expect = 8.1 Identities = 5/23 (21%), Positives = 18/23 (78%) Query: 95 MDNGYIRRGKPTVHIQYDEVTAI 117 ++ G++ KP ++I+++E++++ Sbjct: 357 LEKGFLFLPKPPLYIRFEEISSV 379 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.138 0.399 Gapped Lambda K H 0.267 0.0665 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,748,723 Number of extensions: 138947 Number of successful extensions: 287 Number of sequences better than 10.0: 1 Number of HSP's gapped: 267 Number of HSP's successfully gapped: 16 Length of query: 237 Length of database: 6,263,737 Length adjustment: 91 Effective length of query: 146 Effective length of database: 4,297,318 Effective search space: 627408428 Effective search space used: 627408428 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 56 (25.5 bits)