HHsearch alignment for GI: 254781112 and conserved domain: COG4521

>COG4521 TauA ABC-type taurine transport system, periplasmic component [Inorganic ion transport and metabolism].
Probab=98.08  E-value=0.00022  Score=46.83  Aligned_cols=190  Identities=13%  Similarity=0.124  Sum_probs=108.7

Q ss_pred             CEEEEECCCCCCEEEEEECCCCCEEEEEEEEHHHHHHHCCCCCCCCCCCH-HHHHHHHHCCCCCCC-HHCCCCH---HHH
Q ss_conf             58999628998724870469984889885216789976299855566898-898864310322110-0003675---675
Q gi|254781112|r   42 ALRVGTDGIYPPHSFHAQDGRGELTGFDIDLIKEVAHRLNLKVEFFETAV-SGLITGLDTNRYDVL-VNVAITP---ERQ  116 (274)
Q Consensus        42 ~l~v~~~~~~pP~~~~~~d~~g~~~G~~~dl~~~i~~~lg~~~~~~~~~~-~~~~~~l~~g~~D~~-~~~~~t~---eR~  116 (274)
T Consensus        30 ~vtVgYQt~~eP~kvaqAD------g-------~~aK~~gatiDWRkFdSG~~vv~AlASGdvqiG~iGSsplaaAaSr~   96 (334)
T COG4521          30 DVTVGYQTSAEPAKVAQAD------G-------AFAKESGATIDWRKFDSGASIVRALASGDVQIGNIGSSPLAAAASRQ   96 (334)
T ss_pred             EEEEEEEECCCCCCCCCCC------C-------HHHHHCCCCCCHHHCCCHHHHHHHHHCCCCCCCCCCCCHHHHHHHCC
T ss_conf             1688654035752021346------3-------56776078545110475368999986288610465785666776358


Q ss_pred             HH--HCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCH--HH--HHHHCCCCC---CEE-ECCHHHHHHHHHH
Q ss_conf             42--00233322222222211122221111123343202310101--22--332013454---213-3685577775544
Q gi|254781112|r  117 KK--YDFSIPYIAHRVLLVVRSDQQDIRSFKDLTDKTVAQILGTD--LS--RFAKELKSH---LVF-SHNFEQSLQLLLS  186 (274)
Q Consensus       117 ~~--~~fs~p~~~~~~~~~~~~~~~~~~~~~dL~g~~V~~~~g~~--~~--~~l~~~~~~---~~~-~~~~~~~~~~l~~  186 (274)
T Consensus        97 vpie~f~~~~~ig~sEALVvr~gs-gI~kpeDL~GK~iavPFvSTtHysLLaaLkhw~idp~~V~IlNl~Pp~IaAAwqR  175 (334)
T COG4521          97 VPIEVFLLASQIGNSEALVVRKGS-GIEKPEDLIGKRIAVPFVSTTHYSLLAALKHWGIDPGQVEILNLQPPAIAAAWQR  175 (334)
T ss_pred             CCEEEEEHHHHCCCCCEEEEECCC-CCCCHHHHCCCEECCCEEEHHHHHHHHHHHHCCCCCCCEEEECCCCHHHHHHHHC
T ss_conf             865885301212863103552377-8698578646721042430008999999987187855246861597899999870


Q ss_pred             HHHHCCCCCHHHHHHHHHHCCC-CCCCEEECCCCCCCCCEEEEEECC----CHHHHHHHHHHHHHH
Q ss_conf             3210036655899999984587-667326236776877079998189----989999999999999
Q gi|254781112|r  187 KRTDATMIPDIPFFNFLERRPH-DGNLFKIADRMKDNSAVAFMMRKG----NNKLTRSINEILCAI  247 (274)
Q Consensus       187 grvD~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~k~----~~~L~~~in~~l~~l  247 (274)
T Consensus       176 GDIDgAyVW~PAl~e-l~ksGkVltDs~q-vgqwgaPTfdvwVvrkdfAekhPe~v~aFakv~~da  239 (334)
T COG4521         176 GDIDGAYVWAPALSE-LKKSGKVLTDSEQ-VGQWGAPTFDVWVVRKDFAEKHPEVVAAFAKVALDA  239 (334)
T ss_pred             CCCCCEEECCHHHHH-HHHCCCEECCHHH-HHCCCCCCEEEEEEEHHHHHHCHHHHHHHHHHHHHH
T ss_conf             787722544676888-8625857526888-621479851368863176676969999999988876