BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781112|ref|YP_003065525.1| putative amino acid-binding periplasmic ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] (274 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781112|ref|YP_003065525.1| putative amino acid-binding periplasmic ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 274 Score = 559 bits (1441), Expect = e-161, Method: Compositional matrix adjust. Identities = 274/274 (100%), Positives = 274/274 (100%) Query: 1 MRRLLRDLRKIFFSKYLFFAPFFILFSYYFVIYPFRTEDQSALRVGTDGIYPPHSFHAQD 60 MRRLLRDLRKIFFSKYLFFAPFFILFSYYFVIYPFRTEDQSALRVGTDGIYPPHSFHAQD Sbjct: 1 MRRLLRDLRKIFFSKYLFFAPFFILFSYYFVIYPFRTEDQSALRVGTDGIYPPHSFHAQD 60 Query: 61 GRGELTGFDIDLIKEVAHRLNLKVEFFETAVSGLITGLDTNRYDVLVNVAITPERQKKYD 120 GRGELTGFDIDLIKEVAHRLNLKVEFFETAVSGLITGLDTNRYDVLVNVAITPERQKKYD Sbjct: 61 GRGELTGFDIDLIKEVAHRLNLKVEFFETAVSGLITGLDTNRYDVLVNVAITPERQKKYD 120 Query: 121 FSIPYIAHRVLLVVRSDQQDIRSFKDLTDKTVAQILGTDLSRFAKELKSHLVFSHNFEQS 180 FSIPYIAHRVLLVVRSDQQDIRSFKDLTDKTVAQILGTDLSRFAKELKSHLVFSHNFEQS Sbjct: 121 FSIPYIAHRVLLVVRSDQQDIRSFKDLTDKTVAQILGTDLSRFAKELKSHLVFSHNFEQS 180 Query: 181 LQLLLSKRTDATMIPDIPFFNFLERRPHDGNLFKIADRMKDNSAVAFMMRKGNNKLTRSI 240 LQLLLSKRTDATMIPDIPFFNFLERRPHDGNLFKIADRMKDNSAVAFMMRKGNNKLTRSI Sbjct: 181 LQLLLSKRTDATMIPDIPFFNFLERRPHDGNLFKIADRMKDNSAVAFMMRKGNNKLTRSI 240 Query: 241 NEILCAIHLDGTYKKIFDRYFDKNIISSVPGCSS 274 NEILCAIHLDGTYKKIFDRYFDKNIISSVPGCSS Sbjct: 241 NEILCAIHLDGTYKKIFDRYFDKNIISSVPGCSS 274 >gi|254780956|ref|YP_003065369.1| thymidylate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 264 Score = 25.4 bits (54), Expect = 0.97, Method: Compositional matrix adjust. Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 2/71 (2%) Query: 140 DIRSFKDLTDKTVAQILGTDLSRFAKELKSHLVFSHNFEQS-LQLLLSKRTDATMIPDIP 198 +I S+ LT +A ++G F L +++++FEQ+ LQL S RT MI + Sbjct: 177 NIASYSLLT-MMLASVIGFQYGEFIHTLGDVHLYNNHFEQADLQLSRSPRTLPQMIINPN 235 Query: 199 FFNFLERRPHD 209 + L R D Sbjct: 236 IVDLLSFRYED 246 >gi|254780925|ref|YP_003065338.1| bifunctional preprotein translocase subunit SecD/SecF [Candidatus Liberibacter asiaticus str. psy62] Length = 833 Score = 25.4 bits (54), Expect = 1.0, Method: Compositional matrix adjust. Identities = 24/95 (25%), Positives = 40/95 (42%), Gaps = 19/95 (20%) Query: 63 GELTGFDIDLIKEVAHRLNLKVEFFETAVSGLITGLDTNRYDVLVNVAITPERQKKYDFS 122 G +T +D+ K + +EF TAV+ ++T + + D +V + K Y S Sbjct: 695 GAITTLILDITKTLGFFALFGIEFNLTAVAAVLTLIGYSVNDKVVVYDRMRKNMKLYTTS 754 Query: 123 IPYIAHRVLLVVRSDQQDIRSFKDLTDKTVAQILG 157 I SF+DL DK++ + LG Sbjct: 755 I-------------------SFRDLIDKSINETLG 770 >gi|254780127|ref|YP_003064540.1| putative DNA polymerase from bacteriophage origin [Candidatus Liberibacter asiaticus str. psy62] Length = 675 Score = 24.6 bits (52), Expect = 1.9, Method: Compositional matrix adjust. Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 150 KTVAQILGTDLSRFAKELKSHLVFSHNFEQS 180 KT+A G DL +F++ +KS F ++EQ+ Sbjct: 449 KTMASHCGLDLQQFSQNVKSTSTF-EDWEQA 478 >gi|254780397|ref|YP_003064810.1| 4-hydroxythreonine-4-phosphate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 343 Score = 24.6 bits (52), Expect = 2.1, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 8/48 (16%) Query: 49 GIYPPHSFHAQDGRGELTGF-------DIDLIKEVAHRLNLKVEFFET 89 GI P S A R ++T D+D++ A +LNL V +ET Sbjct: 16 GIGPDISLKAWASR-QITAIPPFIYIGDVDVLNARAKQLNLSVPLYET 62 >gi|254781167|ref|YP_003065580.1| tRNA-dihydrouridine synthase A [Candidatus Liberibacter asiaticus str. psy62] Length = 322 Score = 24.3 bits (51), Expect = 2.5, Method: Compositional matrix adjust. Identities = 12/44 (27%), Positives = 21/44 (47%) Query: 133 VVRSDQQDIRSFKDLTDKTVAQILGTDLSRFAKELKSHLVFSHN 176 ++R D+++I F QI G D+S+ + K F +N Sbjct: 32 ILRGDKKNILGFSTQEKPLALQIGGADISKLVEAAKIVEDFGYN 75 >gi|254780322|ref|YP_003064735.1| SAM-dependent methyltransferase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 273 Score = 24.3 bits (51), Expect = 2.5, Method: Compositional matrix adjust. Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 7/48 (14%) Query: 74 KEVAHRLNLKVEFFETA-----VSGLI--TGLDTNRYDVLVNVAITPE 114 KE+A RLN+ + FE A ++G++ T ++T + ++ I+ E Sbjct: 34 KEIAFRLNMINQTFENALELHGITGIVGYTCMETKKIHRMIRAEISTE 81 >537021.9.peg.753_1 Length = 1033 Score = 23.9 bits (50), Expect = 3.0, Method: Compositional matrix adjust. Identities = 15/47 (31%), Positives = 23/47 (48%) Query: 89 TAVSGLITGLDTNRYDVLVNVAITPERQKKYDFSIPYIAHRVLLVVR 135 TA + IT +D R+ +L + P+R DF I + R V+R Sbjct: 386 TAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRRDEVIR 432 >gi|254780788|ref|YP_003065201.1| transcription elongation factor NusA [Candidatus Liberibacter asiaticus str. psy62] Length = 526 Score = 23.1 bits (48), Expect = 5.6, Method: Compositional matrix adjust. Identities = 10/25 (40%), Positives = 16/25 (64%) Query: 64 ELTGFDIDLIKEVAHRLNLKVEFFE 88 +LTG+ ID+I E +N + +F E Sbjct: 333 QLTGWTIDIITEEEDSINRQKDFNE 357 >gi|254780316|ref|YP_003064729.1| phenylalanyl-tRNA synthetase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 805 Score = 22.7 bits (47), Expect = 6.9, Method: Compositional matrix adjust. Identities = 10/29 (34%), Positives = 15/29 (51%) Query: 83 KVEFFETAVSGLITGLDTNRYDVLVNVAI 111 +++ + G G D N DVLV VA+ Sbjct: 309 RIQSIAGIIGGKHAGCDDNTTDVLVEVAL 337 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.327 0.142 0.417 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 180,246 Number of Sequences: 1233 Number of extensions: 7363 Number of successful extensions: 34 Number of sequences better than 100.0: 13 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 24 Number of HSP's gapped (non-prelim): 13 length of query: 274 length of database: 328,796 effective HSP length: 73 effective length of query: 201 effective length of database: 238,787 effective search space: 47996187 effective search space used: 47996187 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 38 (19.2 bits)