HHsearch alignment for GI: 254781113 and conserved domain: COG4662

>COG4662 TupA ABC-type tungstate transport system, periplasmic component [Coenzyme metabolism].
Probab=99.02  E-value=4.8e-08  Score=62.90  Aligned_cols=199  Identities=12%  Similarity=0.136  Sum_probs=119.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC---CC--C
Q ss_conf             999999999999999999999999999999997067637999999999998555322222211122333210---14--4
Q gi|254781113|r   15 QLLYAAIVVTLPIACISFVISLIIGFFIAVIRIFFSDTIISLIMHFYVWIFRGTPLLVQLFVIFYGLPHIGI---VF--D   89 (226)
Q Consensus        15 ~~l~~~l~~Tl~~~~~~~~i~~~lg~~la~~~~~~~~~~~~~~~~~~i~~~r~iP~lv~l~~~~f~~~~~g~---~~--~   89 (226)
T Consensus        19 ~~l~~iv~~tl~vSl~~i~laalv~~pLa~vl~-~~~frgkr~i~~i~~tl~s~PTVlvGLlLylLlSr~GPlG~f~LLf   97 (227)
T COG4662          19 PELIGIVATTLYVSLISIFLAALVGVPLAFVLA-LREFRGKRFIKMIINTLLSMPTVLVGLLLYLLLSRSGPLGWFNLLF   97 (227)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCCHHHH
T ss_conf             999999999999999999999975328999999-8347547999999988631639999999999996469986303676


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             33333310011000001578999887528336899865174635657787522357644567787889875267999997
Q gi|254781113|r   90 SFVAIIISLTLNFSAYISEIIRSSIISIPKGQWDASYAIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTSVASTI  169 (226)
Q Consensus        90 ~~~~~ii~l~l~~~~~~~~i~r~~l~~v~~~~~EAA~alG~s~~q~~~~iilPqal~~ilp~l~~~~i~lik~tsl~s~i  169 (226)
T Consensus        98 T~~amILGq~iL~lPlvia~~l~ale~~dpr~~ela~~lgas~~kl~~t~~~Earf~l~-aav~agfgR~V~EvG~Ammv  176 (227)
T COG4662          98 TQDAMILGQAILILPLVIAFVLTALESVDPRLKELARSLGASPLKLASTVFREARFGLM-AAVAAGFGRAVAEVGVAMMV  176 (227)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHC
T ss_conf             21069988799999999999999998459789999998099589999999999986799-99999861799986277603


Q ss_pred             HHHHHHHHHHH----HH-HCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             69999999999----98-3235779999999999999999999999999998
Q gi|254781113|r  170 TIPEIFQTAQR----IV-STTYQPLIIYCELAFVYLILTSFCYIIQIKIESS  216 (226)
Q Consensus       170 g~~el~~~a~~----i~-~~~~~~~~~~~~~~~i~l~i~~~~~~l~~~lerr  216 (226)
T Consensus       177 G-GnI~g~TR~itTAIslET~kG~fa~gIaLgiVLlaial~ln~vl~~l~~~  227 (227)
T COG4662         177 G-GNIRGRTRVITTAISLETNKGNFAQGIALGIVLLAIALALNFVLTALQGK  227 (227)
T ss_pred             C-CCCCCEEEEEHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             5-75111223300244356034529885899999999999999999984469