HHsearch alignment for GI: 254781113 and conserved domain: TIGR00969

>TIGR00969 3a0106s02 sulfate ABC transporter, permease protein; InterPro: IPR005667 Bacterial binding protein-dependent transport systems , are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system. The integral inner-membrane proteins translocate the substrate across the membrane. It has been shown , that most of these proteins contain a conserved region located about 80 to 100 residues from their C-terminal extremity. This region seems to be located in a cytoplasmic loop between two transmembrane domains. Apart from the conserved region, the sequence of these proteins is quite divergent, and they have a variable number of transmembrane helices, This entry describes a subfamily of both CysT and CysW, paralogous and generally tandemly encoded permease proteins of the sulphate ABC transporter; GO: 0015563 uptake transmembrane transporter activity, 0006810 transport, 0016020 membrane.
Probab=99.79  E-value=1.4e-18  Score=120.71  Aligned_cols=199  Identities=13%  Similarity=0.112  Sum_probs=133.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHCCCC---
Q ss_conf             9999999999999999999999999999999706763799999999999855532222---2211122333210144---
Q gi|254781113|r   16 LLYAAIVVTLPIACISFVISLIIGFFIAVIRIFFSDTIISLIMHFYVWIFRGTPLLVQ---LFVIFYGLPHIGIVFD---   89 (226)
Q Consensus        16 ~l~~~l~~Tl~~~~~~~~i~~~lg~~la~~~~~~~~~~~~~~~~~~i~~~r~iP~lv~---l~~~~f~~~~~g~~~~---   89 (226)
T Consensus        66 ~~~~A~~lT~~~aliav~lN~vFG~~~AWvLtR~~F-PGr~lLda~~DLPFAlspvVAGL~l~llYg~~Gw~G~~~~~fg  144 (280)
T TIGR00969        66 NAVSAYNLTLLMALIAVPLNGVFGLLIAWVLTRYQF-PGRKLLDALIDLPFALSPVVAGLTLALLYGSNGWLGSWLASFG  144 (280)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCHHHHHHHHHCCCCCCHHHHHHEEEEEECCCCCCCCHHHHCC
T ss_conf             899999999999999999999999999999971269-8258999986213342506753300045357785113230178


Q ss_pred             -----CCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             -----333333100110000015789998875283368998651746356577875223576445677878898752679
Q gi|254781113|r   90 -----SFVAIIISLTLNFSAYISEIIRSSIISIPKGQWDASYAIGLTRKQTIRHIILPQTITTSAVPLSSEFISILKSTS  164 (226)
Q Consensus        90 -----~~~~~ii~l~l~~~~~~~~i~r~~l~~v~~~~~EAA~alG~s~~q~~~~iilPqal~~ilp~l~~~~i~lik~ts  164 (226)
T Consensus       145 iqI~F~~~G~~lAmiFvs~PFVvRev~PVL~Elg~e~EEAA~tLGA~~WQtFwRV~LP~i~w~llyGv~Lt~aRAlGEFG  224 (280)
T TIGR00969       145 IQIIFTWPGVALAMIFVSLPFVVREVQPVLEELGTEAEEAAATLGASGWQTFWRVTLPSIRWALLYGVVLTFARALGEFG  224 (280)
T ss_pred             CEEEEECCCEEEEEEEECCCCEEEEECCCHHHCCCCHHHHHHHCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHCCE
T ss_conf             68998412146665342168045431001341385578999862899830267876688726788867876556543011


Q ss_pred             ----HHHHHHHHHHHHHHHH-HHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             ----9999769999999999-983235779999999999999999999999999998
Q gi|254781113|r  165 ----VASTITIPEIFQTAQR-IVSTTYQPLIIYCELAFVYLILTSFCYIIQIKIESS  216 (226)
Q Consensus       165 ----l~s~ig~~el~~~a~~-i~~~~~~~~~~~~~~~~i~l~i~~~~~~l~~~lerr  216 (226)
T Consensus       225 aV~~vSgni~gkt~~lplli~~~l~~Yd~~gA~~ia~vL-~l~slv~L~~~~~Lq~R  280 (280)
T TIGR00969       225 AVVVVSGNIPGKTLTLPLLIFERLEQYDYPGAYVIAAVL-LLVSLVTLFLINLLQAR  280 (280)
T ss_pred             EEEEEECCCCCCCCCHHHHHHHHHHHCCHHHHHHHHHHH-HHHHHHHHHHHHHHHCC
T ss_conf             078994468863120156644476603607899999999-99999999999985039