RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781114|ref|YP_003065527.1| glycosyl transferase family protein [Candidatus Liberibacter asiaticus str. psy62] (263 letters) >gnl|CDD|185215 PRK15315, PRK15315, outer membrane protein RatA; Provisional. Length = 1865 Score = 27.7 bits (61), Expect = 3.4 Identities = 10/24 (41%), Positives = 13/24 (54%) Query: 177 DMDMKHWWEHNIPSLVTEPGAVYE 200 D+ + W H PSL GAVY+ Sbjct: 1142 DVSVARMWGHMAPSLTAADGAVYQ 1165 >gnl|CDD|167273 PRK01759, glnD, PII uridylyl-transferase; Provisional. Length = 854 Score = 27.0 bits (60), Expect = 5.7 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Query: 32 SFFDAIYGENNPICNRIFSHQKRQCQFKRLLSL 64 SF D E +PIC++IFS Q + LL + Sbjct: 450 SFLDEESAEQHPICHQIFS----QLSDRTLLYI 478 >gnl|CDD|183741 PRK12780, fliR, flagellar biosynthesis protein FliR; Reviewed. Length = 251 Score = 26.6 bits (59), Expect = 6.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Query: 3 IPVYVISLPF 12 IPVY IS PF Sbjct: 211 IPVYFISTPF 220 >gnl|CDD|183971 PRK13317, PRK13317, pantothenate kinase; Provisional. Length = 277 Score = 26.5 bits (59), Expect = 6.5 Identities = 13/53 (24%), Positives = 17/53 (32%), Gaps = 14/53 (26%) Query: 41 NNPICNRIFSHQKRQCQFKRLLSLPEIGCYISHIHLWKRIAYSPAIGAIILED 93 NNP+ I + E G YS AIGA++L Sbjct: 235 NNPLLQEIIESYTKLRNCT--PIFLENG------------GYSGAIGALLLAT 273 >gnl|CDD|184596 PRK14267, PRK14267, phosphate ABC transporter ATP-binding protein; Provisional. Length = 253 Score = 26.7 bits (59), Expect = 6.6 Identities = 21/72 (29%), Positives = 32/72 (44%) Query: 58 FKRLLSLPEIGCYISHIHLWKRIAYSPAIGAIILEDDADFSDEFSQLLPHLSKCDINNIL 117 F RLL L E + L+ R YSP + I + + ++ PHL+ D I Sbjct: 50 FNRLLELNEEARVEGEVRLFGRNIYSPDVDPIEVRREVGMVFQYPNPFPHLTIYDNVAIG 109 Query: 118 IKFDALRKKPKK 129 +K + L K K+ Sbjct: 110 VKLNGLVKSKKE 121 >gnl|CDD|184793 PRK14696, tynA, tyramine oxidase; Provisional. Length = 721 Score = 26.3 bits (58), Expect = 8.9 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 5/72 (6%) Query: 147 ILSPRTTGYFIGKEAAIHLLNVRKNIYRPIDMDMKHWWEHNIPSLVTEPGAVYEAIDTND 206 I +P T GYF GK+ + K + +D+ ++W H I +LV AV + Sbjct: 215 ITTPLTVGYFDGKDGLKQDARLLK-VVSYLDVGDGNYWAHPIENLV----AVVDLEQKKI 269 Query: 207 STIEESRLVRKP 218 IEE +V P Sbjct: 270 IKIEEGPVVPVP 281 >gnl|CDD|162011 TIGR00726, TIGR00726, uncharacterized protein, YfiH family. PSI-BLAST converges on members of this family of uncharacterized bacterial proteins and shows no significant similarity to any characterized protein. No completed genome to date has two members. Members of the family have been crystallized but the function is unknown. Length = 221 Score = 26.2 bits (58), Expect = 9.8 Identities = 13/43 (30%), Positives = 18/43 (41%) Query: 79 RIAYSPAIGAIILEDDADFSDEFSQLLPHLSKCDINNILIKFD 121 PAIG E D + + F +LP+ S I + FD Sbjct: 129 IAVIGPAIGGCCYEVDKEVYEAFRAVLPNASLPFIPDGKYLFD 171 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.324 0.139 0.447 Gapped Lambda K H 0.267 0.0710 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 4,508,735 Number of extensions: 285760 Number of successful extensions: 604 Number of sequences better than 10.0: 1 Number of HSP's gapped: 603 Number of HSP's successfully gapped: 13 Length of query: 263 Length of database: 5,994,473 Length adjustment: 92 Effective length of query: 171 Effective length of database: 4,006,537 Effective search space: 685117827 Effective search space used: 685117827 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 56 (25.4 bits)