RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781114|ref|YP_003065527.1| glycosyl transferase family protein [Candidatus Liberibacter asiaticus str. psy62] (263 letters) >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (A:1221-1330,A:1541-1688) Length = 258 Score = 33.3 bits (76), Expect = 0.034 Identities = 21/89 (23%), Positives = 38/89 (42%), Gaps = 15/89 (16%) Query: 165 LLNV--RKNIYRPIDMDM---KHWWEHNIPSLVTEPGAVYEAIDTNDSTIEESRLVRKPT 219 LN+ RK R + K W E+ + +L E + + D N+ +E +R + Sbjct: 23 NLNMKYRK---RQLVTREAQIKDWVENELEALKLEAEEI-PSEDQNEFLLERTREIHNEA 78 Query: 220 FSPLYFYRNTCYQWNLHYNAWRKDLPPVS 248 S L R QW + +++D P ++ Sbjct: 79 ESQL---RAAQQQWGNDF--YKRD-PRIA 101 >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} (B:1772-1800,B:1916-2006) Length = 120 Score = 29.0 bits (65), Expect = 0.75 Identities = 10/36 (27%), Positives = 13/36 (36%), Gaps = 13/36 (36%) Query: 208 TIEESRLVRKPTFSPLYFYRNTCYQWNLHYNAWRKD 243 +IE LV + FYR Q A +D Sbjct: 7 SIES--LVE------VVFYRGMTMQ-----VAVPRD 29 >2ftz_A Geranyltranstransferase; TM0161, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: MLY; 1.90A {Thermotoga maritima MSB8} (A:131-266) Length = 136 Score = 26.4 bits (58), Expect = 4.4 Identities = 12/63 (19%), Positives = 22/63 (34%), Gaps = 2/63 (3%) Query: 80 IAYSPAIGAIILEDDADFSDEFSQLLPHLSKC--DINNILIKFDALRKKPKKDSYLCTLP 137 A+ + I+ D + + D+ +IL F+ + K KD+ TL Sbjct: 50 FAFCFSAPFILXGXDHTXMXLLGEXFGVAFQIYDDLXDILGSFEKVGKDLGKDTEXVTLV 109 Query: 138 GNF 140 Sbjct: 110 XXV 112 >1wwy_A Thioredoxin-like protein 1; structural genomics, hypothetical protein, regulatory protein, apoptosis, cancer; NMR {Homo sapiens} (A:) Length = 171 Score = 26.3 bits (58), Expect = 4.7 Identities = 14/69 (20%), Positives = 21/69 (30%), Gaps = 5/69 (7%) Query: 87 GAIILEDDADF--SDEFSQLL---PHLSKCDINNILIKFDALRKKPKKDSYLCTLPGNFD 141 L D F SD QLL + ++ + + PK LP + D Sbjct: 32 FDNCLRKDTTFLESDCDEQLLITVAFNQPVKLYSMKFQGPDNGQGPKYVKIFINLPRSMD 91 Query: 142 IHQPRILSP 150 + P Sbjct: 92 FEEAERSEP 100 >3gtx_A Organophosphorus hydrolase; mutant, amidohydrolase, alpha-beta barrel; HET: KCX; 1.62A {Deinococcus radiodurans} PDB: 2zc1_A* 3gti_A* 3gu9_A* 3gtf_A* 3gth_A* 3gu2_A* 3gu1_A* 3fdk_A* 3htw_A* (A:) Length = 339 Score = 25.8 bits (55), Expect = 6.0 Identities = 7/53 (13%), Positives = 16/53 (30%) Query: 66 EIGCYISHIHLWKRIAYSPAIGAIILEDDADFSDEFSQLLPHLSKCDINNILI 118 ++G + H H+ + D A ++ L I ++ Sbjct: 30 QLGATLPHEHVIFGYPGYAGDVTLGPFDHAAALASCTETARALLARGIQTVVD 82 >3f4c_A Organophosphorus hydrolase; alpha-beta barrel, amidohydrolase, binuclear metal enzyme, glycerol-bound; HET: KCX; 2.07A {Geobacillus stearothermophilus 10} PDB: 3f4d_A* (A:) Length = 332 Score = 25.5 bits (54), Expect = 6.9 Identities = 3/47 (6%), Positives = 10/47 (21%) Query: 72 SHIHLWKRIAYSPAIGAIILEDDADFSDEFSQLLPHLSKCDINNILI 118 H H + + + + + I ++ Sbjct: 22 IHEHFLFGYPGFQGDVTRGTFREDEALRVAVEAAEKMKRHGIQTVVD 68 >1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} (A:361-440,A:529-544) Length = 96 Score = 25.6 bits (56), Expect = 7.7 Identities = 3/24 (12%), Positives = 7/24 (29%) Query: 94 DADFSDEFSQLLPHLSKCDINNIL 117 + S+ I+ +L Sbjct: 8 TPHVKKWLQYIFYDASEASIDRVL 31 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.324 0.139 0.447 Gapped Lambda K H 0.267 0.0406 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 2,232,354 Number of extensions: 103996 Number of successful extensions: 321 Number of sequences better than 10.0: 1 Number of HSP's gapped: 321 Number of HSP's successfully gapped: 14 Length of query: 263 Length of database: 4,956,049 Length adjustment: 87 Effective length of query: 176 Effective length of database: 2,015,014 Effective search space: 354642464 Effective search space used: 354642464 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 54 (25.4 bits)