>gi|254781119|ref|YP_003065532.1| hypothetical protein CLIBASIA_05105 [Candidatus Liberibacter asiaticus str. psy62]
MTRVEFVEMKGEVTLLKQKVDCLIAQFNKQQSVIDEFFTILTTAKGFTAFIKGFISIALPIGSFPALRTWIIHHVVGLLKKLFPF