RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254781119|ref|YP_003065532.1| hypothetical protein
CLIBASIA_05105 [Candidatus Liberibacter asiaticus str. psy62]
         (85 letters)



>gnl|CDD|110537 pfam01540, Lipoprotein_7, Adhesin lipoprotein.  This family
           consists of the p50 and variable adherence-associated
           antigen (Vaa) adhesins from Mycoplasma hominis. M.
           hominis is a mycoplasma associated with human urogenital
           diseases, pneumonia, and septic arthritis. An adhesin is
           a cell surface molecule that mediates adhesion to other
           cells or to the surrounding surface or substrate. The
           Vaa antigen is a 50-kDa surface lipoprotein that has
           four tandem repetitive DNA sequences encoding a periodic
           peptide structure, and is highly immunogenic in the
           human host. p50 is also a 50-kDa lipoprotein, having
           three repeats A,B and C, that may be a tetramer of
           191-kDa in its native environment.
          Length = 353

 Score = 27.7 bits (61), Expect = 0.64
 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 16  LKQKVDCLIAQFNKQQSVIDEFFTILTTAKGFT-AFIKGFISI 57
            K++++        +   IDEF T+ +T +GFT A ++ F  I
Sbjct: 165 FKEQLENFADDLLDKSRQIDEFTTVTSTQEGFTLAELESFKEI 207


>gnl|CDD|37692 KOG2481, KOG2481, KOG2481, Protein required for normal rRNA
           processing [RNA processing and modification].
          Length = 570

 Score = 25.8 bits (56), Expect = 2.5
 Identities = 14/60 (23%), Positives = 27/60 (45%), Gaps = 3/60 (5%)

Query: 3   RVEFVEMKG---EVTLLKQKVDCLIAQFNKQQSVIDEFFTILTTAKGFTAFIKGFISIAL 59
           R  F+ +KG   +  +L QK+  ++     +    D  F ++ T   F   + GF++  L
Sbjct: 177 RKVFLSIKGIYYQAEILGQKITWIVPYAFVELHPTDVDFRVMPTFLEFYTTLLGFVNFKL 236


>gnl|CDD|36772 KOG1559, KOG1559, KOG1559, Gamma-glutamyl hydrolase [Coenzyme
           transport and metabolism].
          Length = 340

 Score = 25.4 bits (55), Expect = 3.9
 Identities = 13/38 (34%), Positives = 16/38 (42%), Gaps = 9/38 (23%)

Query: 15  LLKQKVDCLIAQFNK---------QQSVIDEFFTILTT 43
           L K   DCL+ Q +K             +  FF ILTT
Sbjct: 204 LKKLSTDCLVMQNHKFGISPKNFQGNPALSSFFNILTT 241


>gnl|CDD|37715 KOG2504, KOG2504, KOG2504, Monocarboxylate transporter
           [Carbohydrate transport and metabolism].
          Length = 509

 Score = 24.2 bits (52), Expect = 8.9
 Identities = 13/44 (29%), Positives = 18/44 (40%)

Query: 37  FFTILTTAKGFTAFIKGFISIALPIGSFPALRTWIIHHVVGLLK 80
               L  A  +   I   I     +GSF +L   I+  +VGL K
Sbjct: 378 ARLFLPFATTYVGLIVFSILFGFCVGSFSSLTPVILVDLVGLEK 421


>gnl|CDD|111553 pfam02667, SCFA_trans, Short chain fatty acid transporter.  This
           family consists of two sequences annotated as short
           chain fatty acid transporters, however, there are no
           references giving details of experimental
           characterisation of this function.
          Length = 453

 Score = 24.0 bits (52), Expect = 9.0
 Identities = 12/34 (35%), Positives = 17/34 (50%), Gaps = 3/34 (8%)

Query: 32  SVIDEFFTILTTAKGF---TAFIKGFISIALPIG 62
           ++I EFF  +     F   T F  G I+I +P G
Sbjct: 340 TLITEFFINVANKDTFPLMTFFSAGLINIFIPSG 373


>gnl|CDD|147280 pfam05018, DUF667, Protein of unknown function (DUF667).  This
          family of proteins are highly conserved in eukaryotes.
          Some proteins in the family are annotated as
          transcription factors. However, there is currently no
          support for this in the literature.
          Length = 190

 Score = 23.9 bits (52), Expect = 10.0
 Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%)

Query: 49 AFIKGFISIALPIGSFPALRTWIIHHVVGLLKKL 82
          AF  GF+S+   +GS P L+ W +H   G +K++
Sbjct: 5  AFQSGFLSLLYSVGSKP-LQIWDMHTKNGHIKRV 37


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.331    0.144    0.430 

Gapped
Lambda     K      H
   0.267   0.0685    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 1,014,456
Number of extensions: 43914
Number of successful extensions: 136
Number of sequences better than 10.0: 1
Number of HSP's gapped: 136
Number of HSP's successfully gapped: 15
Length of query: 85
Length of database: 6,263,737
Length adjustment: 54
Effective length of query: 31
Effective length of database: 5,096,851
Effective search space: 158002381
Effective search space used: 158002381
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 51 (23.5 bits)