RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254781120|ref|YP_003065533.1| radical SAM protein [Candidatus Liberibacter asiaticus str. psy62] (384 letters) >d1v9ja_ d.52.6.1 (A:) BolA-like protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 Score = 27.1 bits (60), Expect = 2.3 Identities = 9/41 (21%), Positives = 15/41 (36%) Query: 45 RGIRDFQGMSDISQEVRHLLNQHFSIIYPEIVDEKISCDGT 85 RG M + +R L Q + E+ D ++ T Sbjct: 20 RGSEGAATMELSADYLREKLRQDLEAEHVEVEDTTLNRCAT 60 >d1kkha1 d.14.1.5 (A:1-180) Mevalonate kinase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 180 Score = 27.1 bits (59), Expect = 2.3 Identities = 18/105 (17%), Positives = 32/105 (30%), Gaps = 8/105 (7%) Query: 244 HAVSNDLRNILVPINRKYPLEMLIDACRHYPGLSNARRITFEYVMLKGINDSPRDALNLI 303 HAV R I + I+ +E+ N + + + N +P + + Sbjct: 20 HAVVYGYRAISMAIDLTSTIEIKETQEDEIILNLNDLNKSLGLNLNEIKNINPNNFGDFK 79 Query: 304 KILKGIPAKINLIPFNPWPGCEYLCSDQKDIVTFSECIKRSGYSS 348 L I ++ + P G I S+ G S Sbjct: 80 YCLCAIKNTLDYLNIEPKTGF--------KINISSKIPISCGLGS 116 >d2g5da1 b.52.1.4 (A:40-441) Membrane-bound lytic murein transglycosylase A, MLTA {Neisseria gonorrhoeae [TaxId: 485]} Length = 402 Score = 26.1 bits (57), Expect = 5.3 Identities = 5/35 (14%), Positives = 15/35 (42%), Gaps = 6/35 (17%) Query: 61 RHLLNQHFSIIYPEIVDEKISCDGTRKWLLRFPAR 95 R++ ++ + + S G + ++ + P R Sbjct: 253 RYMADKG------YLKLGQTSMQGIKAYMRQNPQR 281 >d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Score = 25.8 bits (57), Expect = 5.4 Identities = 16/59 (27%), Positives = 22/59 (37%), Gaps = 2/59 (3%) Query: 241 ISLHAVSNDLRNILVPINRKYPLEMLIDACRHYPGLS-NARRITFEYVMLKGINDSPRD 298 I+L D + I R PL L+ A GLS R F+ + D+P Sbjct: 2 INLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINE-TDTPAQ 59 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.323 0.140 0.421 Gapped Lambda K H 0.267 0.0570 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 1,472,254 Number of extensions: 71635 Number of successful extensions: 171 Number of sequences better than 10.0: 1 Number of HSP's gapped: 171 Number of HSP's successfully gapped: 8 Length of query: 384 Length of database: 2,407,596 Length adjustment: 87 Effective length of query: 297 Effective length of database: 1,213,086 Effective search space: 360286542 Effective search space used: 360286542 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 54 (24.9 bits)