PSIBLAST alignment of GI: 254781121 and protein with PDB id: 3dtd

>gi|198443315|pdb|3DTD|A Chain A, Crystal Structure Of Invasion Associated Protein B From Bartonella Henselae Length = 175
>gi|198443316|pdb|3DTD|B Chain B, Crystal Structure Of Invasion Associated Protein B From Bartonella Henselae Length = 175
 Score = 51.5 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/157 (15%), Positives = 50/157 (31%), Gaps = 11/157 (7%)

Query: 28  GYANASQPEPTLRNQFSRWSVYVYPDLNKKLCFSLSVPVTVEPLEGVRHGVNFFIISLKK 87
             A       +L   +  WS+       KK+CF           E          +S+  
Sbjct: 14  TVATLPNGASSLTETYGLWSINCGIQEGKKVCFMHRQ-------EVNDQNRVVVAMSVVL 66

Query: 88  EENSAYVSELVMDYPLDEEEMVSLEVKGKNASGTIFKMKSYNNRAAFEKRSQDTVLIEEM 147
             +      L + + +   + V L+V    A      +++            D   +  +
Sbjct: 67  NADGVVSGNLTVPFGILVSKPVRLQVDEGKA-VIETGIRTCVPAGCIVPIVFDKNYVAAL 125

Query: 148 KRGKELVVSAK-SKRGT-NTRYIY-SLIGLSDSLADI 181
           + GK L ++   +  G      ++  L G S++L  +
Sbjct: 126 RAGKHLKLAMTIAAPGEPPLNDLFVQLNGFSNALNRL 162