RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254781121|ref|YP_003065534.1| hypothetical protein CLIBASIA_05115 [Candidatus Liberibacter asiaticus str. psy62] (185 letters) >3dtd_A Invasion-associated protein B; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 2.35A {Bartonella henselae} (A:) Length = 175 Score = 102 bits (256), Expect = 2e-23 Identities = 25/172 (14%), Positives = 50/172 (29%), Gaps = 11/172 (6%) Query: 16 FLIVLMVSSVSAGYANASQPEPTLRNQFSRWSVYVYPDLNKKLCFSLSVPVTVEPLEGVR 75 L ++ A +L + WS+ KK+CF V Sbjct: 2 SLSNSKSTTTKDTVATLPNGASSLTETYGLWSINCGIQEGKKVCFMHRQEVN-------D 54 Query: 76 HGVNFFIISLKKEENSAYVSELVMDYPLDEEEMVSLEVKGKNASGTIFKMKSYNNRAAFE 135 +S+ + L + + + + V L+V A +++ Sbjct: 55 QNRVVVAMSVVLNADGVVSGNLTVPFGILVSKPVRLQVDEGKAVIET-GIRTCVPAGCIV 113 Query: 136 KRSQDTVLIEEMKRGKELVVS---AKSKRGTNTRYIYSLIGLSDSLADIRKC 184 D + ++ GK L ++ A L G S++L + Sbjct: 114 PIVFDKNYVAALRAGKHLKLAMTIAAPGEPPLNDLFVQLNGFSNALNRLIAL 165 >2isb_A Fumarase, FUM-1; NP_069927.1, fumarase of FUM-1, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Archaeoglobus fulgidus} (A:) Length = 192 Score = 28.5 bits (64), Expect = 0.61 Identities = 17/72 (23%), Positives = 28/72 (38%), Gaps = 11/72 (15%) Query: 88 EENSAYVSELVMDYPLDEEEMVSLEVKGK-NASGTIFKMKSYNNRAAFEKRSQDTVLIEE 146 + V E + PL +++++ L+V +G IF R R +E Sbjct: 8 HHHHHXVXEYELRTPLVKDQILKLKVGDVVYITGEIFTA-----RDEAHAR-----ALEW 57 Query: 147 MKRGKELVVSAK 158 + GKEL S Sbjct: 58 XEEGKELPFSFD 69 >1z9l_A Vesicle-associated membrane protein-associated protein A; VAP-A, cytoplasmic domain, protein binding; HET: MSE; 1.70A {Rattus norvegicus} PDB: 1z9o_A (A:) Length = 128 Score = 24.5 bits (53), Expect = 8.5 Identities = 8/37 (21%), Positives = 17/37 (45%) Query: 95 SELVMDYPLDEEEMVSLEVKGKNASGTIFKMKSYNNR 131 S+L P + +L+++ + FK+K+ R Sbjct: 17 SDLKFKGPFTDVVTTNLKLQNPSDRKVCFKVKTTAPR 53 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.319 0.134 0.374 Gapped Lambda K H 0.267 0.0585 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,309,371 Number of extensions: 54342 Number of successful extensions: 85 Number of sequences better than 10.0: 1 Number of HSP's gapped: 82 Number of HSP's successfully gapped: 5 Length of query: 185 Length of database: 4,956,049 Length adjustment: 83 Effective length of query: 102 Effective length of database: 2,150,234 Effective search space: 219323868 Effective search space used: 219323868 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.1 bits)