RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781122|ref|YP_003065535.1| putative thiamine pyrophosphokinase [Candidatus Liberibacter asiaticus str. psy62] (222 letters) >gnl|CDD|153431 cd07995, TPK, Thiamine pyrophosphokinase. Thiamine pyrophosphokinase (TPK, EC:2.7.6.2, also spelled thiamin pyrophosphokinase) catalyzes the transfer of a pyrophosphate group from ATP to vitamin B1 (thiamine) to form the coenzyme thiamine pyrophosphate (TPP). TPP is required for central metabolic functions, and thiamine deficiency is associated with potentially fatal human diseases. The structure of thiamine pyrophosphokinase suggests that the enzyme may operate by a mechanism of pyrophosphoryl transfer similar to those described for pyrophosphokinases functioning in nucleotide biosynthesis. Length = 208 Score = 171 bits (437), Expect = 9e-44 Identities = 73/207 (35%), Positives = 116/207 (56%), Gaps = 6/207 (2%) Query: 12 FAILLNGDIRVTNRLLCAIESC-KVIAADGGICHASQLKVVPELWIGDFDSVDRTLLQQW 70 ILL G + + LL + +IAADGG H L +VP+L IGDFDS+ +L+ + Sbjct: 1 ALILLGGPLPDSPLLLKLWKKADLIIAADGGANHLLDLGIVPDLIIGDFDSISPEVLEYY 60 Query: 71 SS--IKRIFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHITLATSLKK 128 S ++ I +P++KD D E A+ AL+ GA I+++G+ G R D+ L ++ L K Sbjct: 61 KSKGVEIIHFPDEKDFTDFEKALKLALERGADEIVILGATGG-RLDHTLANLNLLLKYAK 119 Query: 129 KNINVTLTSGIEEVFILVPGKHSFDLPEN-SVFSIVCLEDIENITITGAKYTLSHHSLSL 187 I + L E+F+L+PG H+ +L E S++ L ++ +T+ G KY L + +LS Sbjct: 120 DGIKIVLIDEQNEIFLLLPGSHTLELEEEGKYVSLIPLGEVTGLTLKGLKYPLDNATLSF 179 Query: 188 GSSRAVSNVVTKNL-TIMLDQGLAILI 213 GSS SN T T+ ++ GL ++I Sbjct: 180 GSSLGTSNEFTGEKATVSVESGLLLVI 206 >gnl|CDD|31752 COG1564, THI80, Thiamine pyrophosphokinase [Coenzyme metabolism]. Length = 212 Score = 154 bits (390), Expect = 2e-38 Identities = 79/210 (37%), Positives = 123/210 (58%), Gaps = 4/210 (1%) Query: 13 AILLNGDIR-VTNRLLCAIESCKVIAADGGICHASQLKVVPELWIGDFDSVDRTLLQQWS 71 ++LNG I T+RL + K++AADGG H +L +VP+L +GDFDSV LL + Sbjct: 4 VLILNGGILAPTDRLDYLWKFDKIVAADGGANHLLELGLVPDLAVGDFDSVSEELLAYYK 63 Query: 72 SIKR-IFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHITLATSLKKKN 130 I +P +KD D E+A+ +AL+ GA I+++G++ G R D+AL ++ L K Sbjct: 64 EKTVTIKFPAEKDSTDLELALDEALERGADEIVILGALGG-RLDHALANLFLLLRPAKSG 122 Query: 131 INVTLTSGIEEVFILVPGKHSFDLPENSVFSIVCLEDIENITITGAKYTLSHHSLSLGSS 190 +TL SG + L PG+H+ + ++SI ED+ +TI GAKY L + L GSS Sbjct: 123 FKITLISGQNLITPLPPGQHTIEKDPGYLYSIFGGEDVAGLTIKGAKYPLKNADLPFGSS 182 Query: 191 RAVSNVVTKN-LTIMLDQGLAILISRPYDL 219 R++SN + +T+ L G+ ++I+ P DL Sbjct: 183 RSISNEFIGDPVTVSLKSGIVLVIASPDDL 212 >gnl|CDD|113050 pfam04263, TPK_catalytic, Thiamin pyrophosphokinase, catalytic domain. Family of thiamin pyrophosphokinase (EC:2.7.6.2). Thiamin pyrophosphokinase (TPK) catalyses the transfer of a pyrophosphate group from ATP to vitamin B1 (thiamin) to form the coenzyme thiamin pyrophosphate (TPP). Thus, TPK is important for the formation of a coenzyme required for central metabolic functions. The structure of thiamin pyrophosphokinase suggest that the enzyme may operate by a mechanism of pyrophosphoryl transfer similar to those described for pyrophosphokinases functioning in nucleotide biosynthesis. Length = 122 Score = 77.0 bits (190), Expect = 4e-15 Identities = 39/127 (30%), Positives = 64/127 (50%), Gaps = 10/127 (7%) Query: 17 NGDIRVTNRLLCAIESCK-VIAADGGI-CHASQLKVVPELWIGDFDSVD---RTLLQQWS 71 NGD+ R L ++ +AADGG L + P+ +GDFDS+ R ++ Sbjct: 1 NGDLPDFVRDL--WKNADLRVAADGGANHLRDFLSLKPDFVVGDFDSITEELRAYYKEAG 58 Query: 72 SIKRIFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHITLATSLKKKNI 131 F +KD D E+A+ +AL+ GA I+++G++ G R D+AL ++ L L + Sbjct: 59 VNLIHF--PEKDDTDLELALDEALELGADEIVILGALGG-RLDHALANLNLLLRLAYTDN 115 Query: 132 NVTLTSG 138 + L G Sbjct: 116 TIFLLDG 122 >gnl|CDD|38363 KOG3153, KOG3153, KOG3153, Thiamine pyrophosphokinase [Coenzyme transport and metabolism]. Length = 250 Score = 55.3 bits (133), Expect = 1e-08 Identities = 49/207 (23%), Positives = 79/207 (38%), Gaps = 23/207 (11%) Query: 14 ILLNGDIRVTN---RLLCAIESCKVIAADGGICHASQLKVV-----PELWIGDFDSVDRT 65 ++LN +I++ + RLL +V ADGG P+ GDFDS+ Sbjct: 27 VVLNQEIQIPDNRFRLLWKKAKLRV-CADGGANRLYDYLSDRTSEKPDYICGDFDSITEE 85 Query: 66 LLQQWSSIK-RIFYPNDKDMADGEIAV-----HKALQSGARNIILV-GSISGQRFDYALQ 118 + + + + D+D D V HK L I+V G + G RFD + Sbjct: 86 VDDYYKKNGVTVVHTPDQDTTDFTKCVKWIQEHKTLTEWKFLNIVVLGGLGG-RFDQTMA 144 Query: 119 HITLATSLKKKNINVTLTSGIEEVFILVPGKHSFDLPENSVFS------IVCLEDIENIT 172 ++ + L + + +L PGKH +L N + I + T Sbjct: 145 NLNTLYRAVDIQFPIFLLTEDSLIDLLQPGKHRIELHVNLGMTGKWCGLIPIGQPETVKT 204 Query: 173 ITGAKYTLSHHSLSLGSSRAVSNVVTK 199 TG K+ LS+ + G + SN Sbjct: 205 TTGLKWNLSNRRMKFGGLVSTSNTYDG 231 >gnl|CDD|146743 pfam04265, TPK_B1_binding, Thiamin pyrophosphokinase, vitamin B1 binding domain. Family of thiamin pyrophosphokinase (EC:2.7.6.2). Thiamin pyrophosphokinase (TPK) catalyses the transfer of a pyrophosphate group from ATP to vitamin B1 (thiamin) to form the coenzyme thiamin pyrophosphate (TPP). Thus, TPK is important for the formation of a coenzyme required for central metabolic functions. The structure of thiamin pyrophosphokinase suggest that the enzyme may operate by a mechanism of pyrophosphoryl transfer similar to those described for pyrophosphokinases functioning in nucleotide biosynthesis. Length = 66 Score = 45.6 bits (109), Expect = 1e-05 Identities = 17/52 (32%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Query: 148 GKHSFDLPENSV-FSIVCLEDIENITITGAKYTLSHHSLSLGSSRAVSNVVT 198 GKH + S + L + +T G KY L++ LS GSS + SN Sbjct: 1 GKHLIKKEPDYKYCSFIPLGEPVELTTKGLKYPLTNQDLSFGSSISTSNEFI 52 >gnl|CDD|107371 cd06376, PBP1_mGluR_groupIII, Ligand-binding domain of the group III metabotropic glutamate receptor. Ligand-binding domain of the group III metabotropic glutamate receptor, a family which contains mGlu4R, mGluR6R, mGluR7, and mGluR8; all of which inhibit adenylyl cyclase. The metabotropic glutamate receptor is a member of the family C of G-protein-coupled receptors that transduce extracellular signals into G-protein activation and ultimately into intracellular responses. The mGluRs are classified into three groups which comprise eight subtypes. Length = 463 Score = 36.8 bits (85), Expect = 0.004 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 3/85 (3%) Query: 40 GGICHASQLKVVPELWIGDFDSVDRTLLQQWSSIKRIFYPNDKDMADGEIAVHKALQSGA 99 GG+C A +K+ E G+FD + + LL+ ++ I + N+ D+ A +A Q G Sbjct: 200 GGVCIAQSIKIPREPRPGEFDKIIKRLLETPNARAVIIFANEDDIRRVLEAAKRANQVG- 258 Query: 100 RNIILVGSIS-GQRFDYALQHITLA 123 + + VGS S G + LQ +A Sbjct: 259 -HFLWVGSDSWGAKISPILQQEDVA 282 >gnl|CDD|132847 cd07208, Pat_hypo_Ecoli_yjju_like, Hypothetical patatin similar to yjju protein of Escherichia coli. Patatin-like phospholipase similar to yjju protein of Escherichia coli. This family predominantly consists of bacterial patatin glycoproteins, and some representatives from eukaryotes and archaea. The patatin protein accounts for up to 40% of the total soluble protein in potato tubers. Patatin is a storage protein, but it also has the enzymatic activity of a lipid acyl hydrolase, catalyzing the cleavage of fatty acids from membrane lipids. Members of this family have also been found in vertebrates. Length = 266 Score = 29.9 bits (68), Expect = 0.55 Identities = 13/62 (20%), Positives = 27/62 (43%), Gaps = 8/62 (12%) Query: 52 PELW-IGDFDSVDRTLLQQWSSIKRIFYP---NDKDMADGEIA----VHKALQSGARNII 103 + D L+ S++ +F P + + DG ++ V KA++ GA I+ Sbjct: 118 AVYFDKPDILDDLLDALRASSALPGLFPPVRIDGEPYVDGGLSDSIPVDKAIEDGADKIV 177 Query: 104 LV 105 ++ Sbjct: 178 VI 179 >gnl|CDD|107357 cd06362, PBP1_mGluR, Ligand binding domain of the metabotropic glutamate receptors (mGluR). Ligand binding domain of the metabotropic glutamate receptors (mGluR), which are members of the family C of G-protein-coupled receptors that transduce extracellular signals into G-protein activation and ultimately into cellular responses. mGluRs bind to glutamate and function as an excitatory neurotransmitter; they are involved in learning, memory, anxiety, and the perception of pain. Eight subtypes of mGluRs have been cloned so far, and are classified into three groups according to their sequence similarities, transduction mechanisms, and pharmacological profiles. Group I is composed of mGlu1R and mGlu5R that both stimulate PLC hydrolysis. Group II includes mGlu2R and mGlu3R, which inhibit adenylyl cyclase, as do mGlu4R, mGlu6R, mGlu7R, and mGlu8R, which form group III. Length = 452 Score = 29.1 bits (66), Expect = 0.95 Identities = 14/41 (34%), Positives = 23/41 (56%) Query: 29 AIESCKVIAADGGICHASQLKVVPELWIGDFDSVDRTLLQQ 69 IE+ + +AA+ GIC A K+ +FD++ R LL + Sbjct: 188 GIEAFEKLAAERGICIAGSEKIPSSATEEEFDNIIRKLLSK 228 >gnl|CDD|31013 COG0669, CoaD, Phosphopantetheine adenylyltransferase [Coenzyme metabolism]. Length = 159 Score = 28.6 bits (64), Expect = 1.4 Identities = 17/62 (27%), Positives = 31/62 (50%), Gaps = 10/62 (16%) Query: 91 VHKALQSGARNIILVGSISGQRFDYALQHITLATSLKKKNINVTLTSGIEEVFILVPGKH 150 V A + GA +++ G + F+Y LQ +A ++N L +E VF++ ++ Sbjct: 75 VDYAKKLGA-TVLVRGLRAVSDFEYELQ---MA------HMNRKLAPEVETVFLMPSPEY 124 Query: 151 SF 152 SF Sbjct: 125 SF 126 >gnl|CDD|30971 COG0626, MetC, Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism]. Length = 396 Score = 28.6 bits (64), Expect = 1.4 Identities = 15/63 (23%), Positives = 27/63 (42%), Gaps = 5/63 (7%) Query: 67 LQQWSSIKRIFYPNDKDMADGEIAVHKALQSGARNII---LVGSISGQRFDYALQHITLA 123 L +K+++YP E+A K +G + L + ++F +L+ LA Sbjct: 279 LADHPKVKKVYYPGLPSHPGHELA--KRQMTGYGGLFSFELKNEEAAKKFLDSLKLFKLA 336 Query: 124 TSL 126 SL Sbjct: 337 ESL 339 >gnl|CDD|29469 cd02773, MopB_Res-Cmplx1_Nad11, MopB_Res_Cmplx1_Nad11: The second domain of the Nad11/75-kDa subunit of the NADH-quinone oxidoreductase/respiratory complex I/NADH dehydrogenase-1(NDH-1) of eukaryotes and the Nqo3/G subunit of alphaproteobacteria NDH-1. The NADH-quinone oxidoreductase is the first energy-transducting complex in the respiratory chains of many prokaryotes and eukaryotes. Mitochondrial complex I and its bacterial counterpart, NDH-1, function as a redox pump that uses the redox energy to translocate H+ ions across the membrane, resulting in a significant contribution to energy production. The nad11 gene codes for the largest (75 kDa) subunit of the mitochondrial NADH:ubiquinone oxidoreductase, it constitutes the electron input part of the enzyme, or the so-called NADH dehydrogenase fragment. In Paracoccus denitrificans, this subunit is encoded by the nqo3 gene, and is part of the 14 distinct subunits constituting the 'minimal' functional enzyme. The Nad11/Nqo3 subunit is made of two domains: the first contains three binding sites for FeS clusters (the fer2 domain), the second domain (this CD), is of unknown function or, as postulated, has lost an ancestral formate dehydrogenase activity that became redundant during the evolution of the complex I enzyme. Although only vestigial sequence evidence remains of a molybdopterin binding site, this protein domain belongs to the molybdopterin_binding (MopB) superfamily of proteins.. Length = 375 Score = 27.9 bits (62), Expect = 2.1 Identities = 16/50 (32%), Positives = 26/50 (52%) Query: 82 KDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHITLATSLKKKNI 131 +D+A G+ KAL+ + +I+VGS + R D A +A KK + Sbjct: 202 QDIASGKHPFSKALKDAKKPMIIVGSGALARKDGAAILAAVAKLAKKNGV 251 >gnl|CDD|39584 KOG4383, KOG4383, KOG4383, Uncharacterized conserved protein [Function unknown]. Length = 1354 Score = 27.1 bits (59), Expect = 3.8 Identities = 16/75 (21%), Positives = 28/75 (37%), Gaps = 2/75 (2%) Query: 89 IAVHKALQSGARNIILVGSISGQ--RFDYALQHITLATSLKKKNINVTLTSGIEEVFILV 146 I + + ++ L +SG F Y LA+ L K I + L ++ Sbjct: 717 IPLSGRDKKKVKDFYLRACLSGHCLAFAYKPCFCALASQLAGKCIELPLNPEHSKIETAC 776 Query: 147 PGKHSFDLPENSVFS 161 HS + +N+ S Sbjct: 777 ELPHSIPIKQNARES 791 >gnl|CDD|176192 cd08230, glucose_DH, Glucose dehydrogenase. Glucose dehydrogenase (GlcDH), a member of the medium chain dehydrogenase/zinc-dependent alcohol dehydrogenase-like family, catalyzes the NADP(+)-dependent oxidation of glucose to gluconate, the first step in the Entner-Doudoroff pathway, an alternative to or substitute for glycolysis or the pentose phosphate pathway. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossman fold domain of a beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. The MDR group contains a host of activities, including the founding alcohol dehydrogenase (ADH), quinone reductase, sorbitol dehydrogenase, formaldehyde dehydrogenase, butanediol DH, ketose reductase, cinnamyl reductase, and numerous others. The zinc-dependent alcohol dehydrogenases (ADHs) catalyze the NAD(P)(H)-dependent interconversion of alcohols to aldehydes or ketones. Active site zinc has a catalytic role, while structural zinc aids in stability. Length = 355 Score = 26.8 bits (60), Expect = 5.4 Identities = 6/26 (23%), Positives = 13/26 (50%), Gaps = 2/26 (7%) Query: 100 RNIILVGSISGQRFDY--ALQHITLA 123 N LVGS++ + + A++ + Sbjct: 291 GNKALVGSVNANKRHFEQAVEDLAQW 316 >gnl|CDD|31504 COG1313, PflX, Uncharacterized Fe-S protein PflX, homolog of pyruvate formate lyase activating proteins [General function prediction only]. Length = 335 Score = 26.4 bits (58), Expect = 6.4 Identities = 22/116 (18%), Positives = 41/116 (35%), Gaps = 20/116 (17%) Query: 98 GARNIILVGSISGQRFDYALQHITLATSLKKKNINVTLTSGIEEVFILVPGKHSFDLPEN 157 GA+N+ VG + L+ + A +NI V S + E Sbjct: 165 GAKNVNFVGGDPTPHLPFILEALRYA----SENIPVVWNSN------------MYMSEE- 207 Query: 158 SVFSIVCLEDIENITITGAKYTLSHHSLSLGSSRAVSNVVTKNLTIMLDQGLAILI 213 ++ L+ + +I + KY + VVT+N+ +Q ++I Sbjct: 208 ---TLKLLDGVVDIYLPDFKYGNDECAEKYSKVPNYWEVVTRNILEAKEQVGGLII 260 >gnl|CDD|112651 pfam03848, TehB, Tellurite resistance protein TehB. Length = 192 Score = 26.3 bits (58), Expect = 6.8 Identities = 22/93 (23%), Positives = 37/93 (39%), Gaps = 22/93 (23%) Query: 127 KKKNINVTLTSGIEEVFILVPGK----------------------HSFDLPENSVFSIVC 164 KK N T + +E V + PGK + D ENS+ ++ Sbjct: 11 KKYNTTPTHSEVLEAVKTVKPGKALDLGCGQGRNSLFLSLLGYDVTAVDHNENSIANLQD 70 Query: 165 LEDIENITITGAKYTLSHHSLSLGSSRAVSNVV 197 +++ EN+ I A Y ++ S+ +S VV Sbjct: 71 IKEKENLDIPTALYDINSASIDENYDFILSTVV 103 >gnl|CDD|144562 pfam01019, G_glu_transpept, Gamma-glutamyltranspeptidase. Length = 506 Score = 25.7 bits (57), Expect = 9.5 Identities = 8/32 (25%), Positives = 13/32 (40%) Query: 64 RTLLQQWSSIKRIFYPNDKDMADGEIAVHKAL 95 L+ + +IF P K G++ AL Sbjct: 131 EPRLRADPGLAKIFLPTGKPPKAGDLLKQPAL 162 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.137 0.393 Gapped Lambda K H 0.267 0.0806 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,581,153 Number of extensions: 130321 Number of successful extensions: 271 Number of sequences better than 10.0: 1 Number of HSP's gapped: 261 Number of HSP's successfully gapped: 20 Length of query: 222 Length of database: 6,263,737 Length adjustment: 90 Effective length of query: 132 Effective length of database: 4,318,927 Effective search space: 570098364 Effective search space used: 570098364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (24.8 bits)