BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781122|ref|YP_003065535.1| putative thiamine pyrophosphokinase [Candidatus Liberibacter asiaticus str. psy62] (222 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781122|ref|YP_003065535.1| putative thiamine pyrophosphokinase [Candidatus Liberibacter asiaticus str. psy62] Length = 222 Score = 454 bits (1168), Expect = e-130, Method: Compositional matrix adjust. Identities = 222/222 (100%), Positives = 222/222 (100%) Query: 1 MSLSHTNKFIDFAILLNGDIRVTNRLLCAIESCKVIAADGGICHASQLKVVPELWIGDFD 60 MSLSHTNKFIDFAILLNGDIRVTNRLLCAIESCKVIAADGGICHASQLKVVPELWIGDFD Sbjct: 1 MSLSHTNKFIDFAILLNGDIRVTNRLLCAIESCKVIAADGGICHASQLKVVPELWIGDFD 60 Query: 61 SVDRTLLQQWSSIKRIFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHI 120 SVDRTLLQQWSSIKRIFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHI Sbjct: 61 SVDRTLLQQWSSIKRIFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFDYALQHI 120 Query: 121 TLATSLKKKNINVTLTSGIEEVFILVPGKHSFDLPENSVFSIVCLEDIENITITGAKYTL 180 TLATSLKKKNINVTLTSGIEEVFILVPGKHSFDLPENSVFSIVCLEDIENITITGAKYTL Sbjct: 121 TLATSLKKKNINVTLTSGIEEVFILVPGKHSFDLPENSVFSIVCLEDIENITITGAKYTL 180 Query: 181 SHHSLSLGSSRAVSNVVTKNLTIMLDQGLAILISRPYDLQRF 222 SHHSLSLGSSRAVSNVVTKNLTIMLDQGLAILISRPYDLQRF Sbjct: 181 SHHSLSLGSSRAVSNVVTKNLTIMLDQGLAILISRPYDLQRF 222 >gi|254780602|ref|YP_003065015.1| aspartate aminotransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 400 Score = 26.6 bits (57), Expect = 0.42, Method: Compositional matrix adjust. Identities = 28/117 (23%), Positives = 46/117 (39%), Gaps = 29/117 (24%) Query: 123 ATSLKKKNINVTLTSGIEEVFILVPGKHSFDLPENSVFSIV-CLEDIENITITGAKYT-- 179 AT + + + + GI+ V L G+ FD+PEN +++V +E E KYT Sbjct: 15 ATLVAAQRVRDLRSKGID-VLCLTAGEPDFDMPENVKYAVVRAMERGET------KYTAV 67 Query: 180 -------------------LSHHSLSLGSSRAVSNVVTKNLTIMLDQGLAILISRPY 217 L + S + +V+ L ++ G +LI RPY Sbjct: 68 AGISPLREAIVEKFRRDNDLHYTSDQIIVGTGAKHVIFNALMATVNMGDEVLIPRPY 124 >gi|254780964|ref|YP_003065377.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Score = 23.9 bits (50), Expect = 2.2, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Query: 24 NRLLCAIESCKVIAADG------GICHASQLKVV-PELWIGDFDSVDRTLLQQ 69 N+++ E + I D GI +Q+K+ P LW +F RT+L + Sbjct: 215 NKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267 >gi|254780845|ref|YP_003065258.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Score = 23.9 bits (50), Expect = 2.2, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Query: 24 NRLLCAIESCKVIAADG------GICHASQLKVV-PELWIGDFDSVDRTLLQQ 69 N+++ E + I D GI +Q+K+ P LW +F RT+L + Sbjct: 215 NKMVGIAEQYQYIMRDESLHLNFGIDVINQIKIENPHLWTKEFQQKSRTMLHE 267 >537021.9.peg.75_1 Length = 136 Score = 23.5 bits (49), Expect = 3.6, Method: Compositional matrix adjust. Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 41 GICHASQLKVV-PELWIGDFDSVDRTLLQQ 69 GI +Q+K+ P LW +F RT+L + Sbjct: 22 GIDVINQIKIENPHLWTKEFQQKSRTMLHE 51 >gi|254781006|ref|YP_003065419.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Score = 23.1 bits (48), Expect = 3.6, Method: Compositional matrix adjust. Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 41 GICHASQLKVV-PELWIGDFDSVDRTLLQQ 69 GI +Q+K+ P LW +F RT+L + Sbjct: 11 GIDVINQIKIENPHLWTKEFQQKSRTMLHE 40 >gi|254780136|ref|YP_003064549.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Score = 23.1 bits (48), Expect = 3.6, Method: Compositional matrix adjust. Identities = 11/30 (36%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 41 GICHASQLKVV-PELWIGDFDSVDRTLLQQ 69 GI +Q+K+ P LW +F RT+L + Sbjct: 11 GIDVINQIKIENPHLWTKEFQQKSRTMLHE 40 >gi|254780569|ref|YP_003064982.1| phosphoribosylaminoimidazole synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 357 Score = 22.3 bits (46), Expect = 6.7, Method: Compositional matrix adjust. Identities = 13/39 (33%), Positives = 21/39 (53%), Gaps = 7/39 (17%) Query: 76 IFYPNDKDMADGEIAVHKALQSGARNIILVGSISGQRFD 114 I +P++KD + K Q NIIL+G ++ QR + Sbjct: 313 IVHPDNKD------CIIKKFQENNENIILIGEVT-QRSE 344 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.322 0.137 0.393 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 140,039 Number of Sequences: 1233 Number of extensions: 5693 Number of successful extensions: 19 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 8 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 11 length of query: 222 length of database: 328,796 effective HSP length: 71 effective length of query: 151 effective length of database: 241,253 effective search space: 36429203 effective search space used: 36429203 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 36 (18.5 bits)