RPSBLAST alignment for GI: 254781123 and conserved domain: TIGR01257

>gnl|CDD|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter. This model describes the photoreceptor protein (rim protein) in eukaryotes. It is the member of ABC transporter superfamily. Rim protein is a membrane glycoprotein which is localized in the photoreceptor outer segment discs. Mutation/s in its genetic loci is implicated in the recessive Stargardt's disease. Length = 2272
 Score = 43.1 bits (101), Expect = 2e-04
 Identities = 43/162 (26%), Positives = 69/162 (42%), Gaps = 26/162 (16%)

Query: 36   LVGCNGSGKSTLLKIAAGITEPQSGNVFLHSS----------SRLGYLEQNPDLSHFSTI 85
             +G NG+GK+T L I  G+  P SG V +               LG   Q+  L H  T+
Sbjct: 961  FLGHNGAGKTTTLSILTGLLPPTSGTVLVGGKDIETNLDAVRQSLGMCPQHNILFHHLTV 1020

Query: 86   SQYI----------DDTIKDTIEAPYSPYSLLKKFNLREQDRIENLSVGQTRCVALMKML 135
            +++I           +  +  +EA      L  K N   QD    LS G  R +++    
Sbjct: 1021 AEHILFYAQLKGRSWEEAQLEMEAMLEDTGLHHKRNEEAQD----LSGGMQRKLSVAIAF 1076

Query: 136  ISRPDILILDEPTNHLDFRTIHWMEQELLKINSA--LIFVSH 175
            +    +++LDEPT+ +D  +   +   LLK  S   +I  +H
Sbjct: 1077 VGDAKVVVLDEPTSGVDPYSRRSIWDLLLKYRSGRTIIMSTH 1118