RPSBLAST alignment for GI: 254781123 and conserved domain: TIGR02142

>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein. This model represents the ATP-binding cassette (ABC) protein of the three subunit molybdate ABC transporter. The three proteins of this complex are homologous to proteins of the sulfate ABC transporter. Molybdenum may be used in nitrogenases of nitrogen-fixing bacteria and in molybdopterin cofactors. In some cases, molybdate may be transported by a sulfate transporter rather than by a specific molybdate transporter. Length = 354
 Score = 59.7 bits (145), Expect = 2e-09
 Identities = 50/207 (24%), Positives = 90/207 (43%), Gaps = 27/207 (13%)

Query: 11  ISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLH----- 65
            S  +G   L  D   ++  +    + G +GSGK+TL+++ AG+T P  G + L+     
Sbjct: 5   FSKRLGDFSL--DADFTLPGQGVTAIFGRSGSGKTTLIRLIAGLTRPDEGEIVLNGRTLF 62

Query: 66  SSS----------RLGYLEQNPDL-SHFSTISQ----YIDDTIKDTIEAPYSPYSLLKKF 110
            S           R+GY+ Q   L  H S               +   +      LL   
Sbjct: 63  DSRKGIFLPPEKRRIGYVFQEARLFPHLSVRGNLRYGMKRARPSERRISFERVIELLGIG 122

Query: 111 NLREQDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLD----FRTIHWMEQELLKI 166
           +L  +     LS G+ + VA+ + L+S P +L++DEP   LD    +  + ++E+   + 
Sbjct: 123 HLLGR-LPGRLSGGEKQRVAIGRALLSSPRLLLMDEPLAALDDPRKYEILPYLERLHAEF 181

Query: 167 NSALIFVSHDRRFLETLSTTTVWLDRG 193
              +++VSH  + +  L+   V L+ G
Sbjct: 182 GIPILYVSHSLQEVLRLADRVVVLEDG 208