RPSBLAST alignment for GI: 254781123 and conserved domain: TIGR02673

>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE. This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein. Length = 214
 Score = 80.4 bits (199), Expect = 1e-15
 Identities = 60/204 (29%), Positives = 99/204 (48%), Gaps = 19/204 (9%)

Query: 284 VLEADKITKQYD-DRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFIT 342
           ++E   ++K Y      + D SL I  GE + + GP+GAGKTTLLKLL G + P  G + 
Sbjct: 1   MIEFHNVSKAYPGGVAALHDVSLHIRKGEFLFLTGPSGAGKTTLLKLLYGALTPSRGQVR 60

Query: 343 L-GTNL------KIATIDQKREDIDPDKSLASYLT--GSSGDSLMVRG----ESRHVAGY 389
           + G ++      ++  + ++   +  D  L    T   +    L VRG    E +   G 
Sbjct: 61  IAGEDVNRLRGRQLPLLRRRIGVVFQDFRLLPDRTVYENVALPLEVRGKKEREIQRRVGA 120

Query: 390 IKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFET----LDFL 445
               +    +A +  + LSGGE+ R  +AR +      L+ DEPT +LD +     LD L
Sbjct: 121 ALRQVGLEHKADAFPEQLSGGEQQRVAIARAIVNSPPLLLADEPTGNLDPDLSERILDLL 180

Query: 446 ERTITQLQGTILIVSHDRDFLDRT 469
           +R + +   T+++ +HD   +DR 
Sbjct: 181 KR-LNKRGTTVIVATHDLSLVDRV 203