RPSBLAST alignment for GI: 254781123 and conserved domain: TIGR02770

>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD. This family represents the NikD subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. NikD and NikE are homologous. Length = 230
 Score = 65.5 bits (160), Expect = 4e-11
 Identities = 59/192 (30%), Positives = 86/192 (44%), Gaps = 37/192 (19%)

Query: 300 VKDFSLRIHYGECIGIVGPNGAGKTT----LLKLLTGKIKPDCGFITL-GTNL------- 347
           V+D +L +  GE + +VG +G+GK+     +L LL   +    G I L G  L       
Sbjct: 2   VQDLNLSLKRGEVLALVGESGSGKSLTCLAILGLLPPGLTQTSGEILLDGRPLLPLSIRG 61

Query: 348 -KIATIDQK-REDIDPDKSLASYLTGSSGDSLMVRGESRHVAGYIKDFLFH-------PD 398
             IATI Q  R   +P  ++ ++      ++L   G+    A   +  +         PD
Sbjct: 62  RHIATIMQNPRTAFNPLFTMGNHAI----ETLRSLGKLSKQA---RALILEALEAVGLPD 114

Query: 399 QAHSLMKH---LSGGEKMRAIVARVLAQPFNFLIMDEPTNDLD----FETLDFLERTITQ 451
               L K+   LSGG   R ++A  L     FLI DEPT DLD       L  L   + Q
Sbjct: 115 PEEVLKKYPFQLSGGMLQRVMIALALLLEPPFLIADEPTTDLDVVNQARVLKLLRE-LRQ 173

Query: 452 LQGT-ILIVSHD 462
           L GT IL+++HD
Sbjct: 174 LFGTGILLITHD 185