RPSBLAST alignment for GI: 254781123 and conserved domain: TIGR03005

>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins. Length = 252
 Score = 54.1 bits (130), Expect = 1e-07
 Identities = 52/227 (22%), Positives = 90/227 (39%), Gaps = 37/227 (16%)

Query: 6   LRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIA---AGITEPQ---S 59
           +R   ++   G + +L  +  S+   E++ L+G +GSGKST+L+I      I E Q    
Sbjct: 1   VRFSDVTKRFGILTVLDGLNFSVAAGEKVALIGPSGSGKSTILRILMTLEPIDEGQIQVE 60

Query: 60  GNVFLHSSSRLGYLEQNPDLSHFSTISQYID------------DTIKDTIEAPY------ 101
           G    H   R G L    D  H   +   I               + +  EAP       
Sbjct: 61  GEQLYHMPGRNGPLVP-ADEKHLRQMRNKIGMVFQSFNLFPHKTVLDNVTEAPVLVLGMA 119

Query: 102 ------SPYSLLKKFNLREQDRI--ENLSVGQTRCVALMKMLISRPDILILDEPTNHLDF 153
                     LL    L ++       LS GQ + VA+ + L  RP +++ DE T+ LD 
Sbjct: 120 RAEAEKRAMELLDMVGLADKADHMPAQLSGGQQQRVAIARALAMRPKVMLFDEVTSALDP 179

Query: 154 RTIHWMEQELLKINS----ALIFVSHDRRFLETLSTTTVWLDRGCLH 196
             +  +   + ++ S     ++ V+H+  F    +    + D+G + 
Sbjct: 180 ELVGEVLNVIRRLASEHDLTMLLVTHEMGFAREFADRVCFFDKGRIV 226