RPSBLAST alignment for GI: 254781123 and conserved domain: TIGR03375

>gnl|CDD|163239 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export. Length = 694
 Score = 75.7 bits (187), Expect = 4e-14
 Identities = 60/215 (27%), Positives = 95/215 (44%), Gaps = 46/215 (21%)

Query: 285 LEADKITKQY--DDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFIT 342
           +E   ++  Y   +   + + SL I  GE + I+G  G+GK+TLLKLL G  +P  G + 
Sbjct: 464 IEFRNVSFAYPGQETPALDNVSLTIRPGEKVAIIGRIGSGKSTLLKLLLGLYQPTEGSVL 523

Query: 343 LGTNLKIATID------------QK--------REDIDPDKSLASYLTGSSGDSLMVRG- 381
           L   + I  ID            Q         R++I      A        D  ++R  
Sbjct: 524 LD-GVDIRQIDPADLRRNIGYVPQDPRLFYGTLRDNIALGAPYAD-------DEEILRAA 575

Query: 382 ESRHVAGYIKDFLFHPD----QAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDL 437
           E   V  +++    HPD    Q     + LSGG++    +AR L +    L++DEPT+ +
Sbjct: 576 ELAGVTEFVRR---HPDGLDMQIGERGRSLSGGQRQAVALARALLRDPPILLLDEPTSAM 632

Query: 438 DFET----LDFLERTITQLQG-TILIVSHDRDFLD 467
           D  +     D L+R    L G T+++V+H    LD
Sbjct: 633 DNRSEERFKDRLKRW---LAGKTLVLVTHRTSLLD 664