RPSBLAST alignment for GI: 254781123 and conserved domain: TIGR03719

>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family. Members of this protein family have two copies of the ABC transporter ATP-binding cassette, but are found outside the common ABC transporter operon structure that features integral membrane permease proteins and substrate-binding proteins encoded next to the ATP-binding cassette (ABC domain) protein. The member protein ChvD from Agrobacterium tumefaciens was identified as both a candidate to interact with VirB8, based on yeast two-hybrid analysis, and as an apparent regulator of VirG. The general function of this protein family is unknown. Length = 552
 Score = 83.0 bits (206), Expect = 2e-16
 Identities = 51/157 (32%), Positives = 84/157 (53%), Gaps = 11/157 (7%)

Query: 406 HLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQGTILIVSHDRDF 465
            LSGGE+ R  + R+L    + L++DEPTN LD E++ +LE+ + +  GT++ V+HDR F
Sbjct: 161 KLSGGERRRVALCRLLLSKPDMLLLDEPTNHLDAESVAWLEQHLQEYPGTVVAVTHDRYF 220

Query: 466 LDRTVTSTIAAQNIEDPNGYWIKYAGGYSDMLVQQKKSHPTPQKKNPPAQ-SLQEE---- 520
           LD  V   I    +E   G  I + G YS  L Q++K     +K+    Q +L+ E    
Sbjct: 221 LD-NVAGWI----LELDRGRGIPWEGNYSSWLEQKEKRLEQEEKEESARQKALKRELEWV 275

Query: 521 -TVKKEKKQKRKNRLSYSQKLLLERLPQEIHKIQLKI 556
            +  K ++ K K RL+  ++LL +   +     ++ I
Sbjct: 276 RSSPKARQAKSKARLARYEELLSQEFQKRNETAEIYI 312