RPSBLAST alignment for GI: 254781123 and conserved domain: TIGR03771

>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit. This protein family is the ATP-binding cassette subunit of binding protein-dependent ABC transporter complex that strictly co-occurs with TIGR03769. TIGRFAMs model TIGR03769 describes a protein domain that occurs singly or as one of up to three repeats in proteins of a number of Actinobacteria, including Propionibacterium acnes KPA171202. The TIGR03769 domain occurs both in an adjacent gene for the substrate-binding protein and in additional (often nearby) proteins, often with LPXTG-like sortase recognition signals. Homologous ATP-binding subunits outside the scope of this family include manganese transporter MntA in Synechocystis sp. PCC 6803 and chelated iron transporter subunits. The function of this transporter complex is unknown. Length = 223
 Score = 56.0 bits (135), Expect = 3e-08
 Identities = 50/180 (27%), Positives = 78/180 (43%), Gaps = 37/180 (20%)

Query: 26  LSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHSSS------RLGYLEQNPDL 79
           LS    E + L+G NG+GK+TLL+   G+  P  G V +  +S       +GY+ Q  + 
Sbjct: 1   LSADKGELLGLLGPNGAGKTTLLRAILGLIPPAKGTVKVAGASPGKGWRHIGYVPQRHEF 60

Query: 80  SHFSTISQY------------------IDDTIKDTIEAPYSPYSLLKKFNLRE-QDR-IE 119
           +    IS                    + D      +A       L++  L E  DR + 
Sbjct: 61  AWDFPISVAHTVMSGRTGHIGWLRRPCVADFAA-VRDA-------LRRVGLTELADRPVG 112

Query: 120 NLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWME---QELLKINSALIFVSHD 176
            LS GQ + V + + L +RP +L+LDEP   LD  T   +     EL    +A++  +HD
Sbjct: 113 ELSGGQRQRVLVARALATRPSVLLLDEPFTGLDMPTQELLTELFIELAGAGTAILMTTHD 172