RPSBLAST alignment for GI: 254781123 and conserved domain: TIGR03796

>gnl|CDD|163508 TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein. This protein describes an multidomain ABC transporter subunit that is one of three protein families associated with some regularity with a distinctive family of putative bacteriocins. It includes a bacteriocin-processing peptidase domain at the N-terminus. Model TIGR03793 describes a conserved propeptide region for this bacteriocin family, unusual because it shows obvious homology a region of the enzyme nitrile hydratase up to the classic Gly-Gly cleavage motif. This family is therefore predicted to be a subunit of a bacteriocin processing and export system characteristic to this system that we designate NHPM, Nitrile Hydratase Propeptide Microcin. Length = 710
 Score = 63.4 bits (155), Expect = 2e-10
 Identities = 56/213 (26%), Positives = 97/213 (45%), Gaps = 36/213 (16%)

Query: 276 TTQSSGKLV--LEADKITKQY--DDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLT 331
            ++ S +L   +E   IT  Y   +  ++++FSL +  G+ + +VG +G+GK+T+ KL+ 
Sbjct: 467 GSEPSPRLSGYVELRNITFGYSPLEPPLIENFSLTLQPGQRVALVGGSGSGKSTIAKLVA 526

Query: 332 GKIKPDCGFITLGTNLKIATIDQKREDIDPDKSLASYLTGSSGDSLMVRGESR------- 384
           G  +P  G I              RE+I P + LA+ +     D  +  G  R       
Sbjct: 527 GLYQPWSGEILFD--------GIPREEI-PREVLANSVAMVDQDIFLFEGTVRDNLTLWD 577

Query: 385 ------HVAGYIKDFLFH------PDQAHSLM----KHLSGGEKMRAIVARVLAQPFNFL 428
                  +    KD   H      P    + +     +LSGG++ R  +AR L +  + L
Sbjct: 578 PTIPDADLVRACKDAAIHDVITSRPGGYDAELAEGGANLSGGQRQRLEIARALVRNPSIL 637

Query: 429 IMDEPTNDLDFETLDFLERTITQLQGTILIVSH 461
           I+DE T+ LD ET   ++  + +   T +IV+H
Sbjct: 638 ILDEATSALDPETEKIIDDNLRRRGCTCIIVAH 670