RPSBLAST alignment for GI: 254781123 and conserved domain: TIGR03864

>gnl|CDD|163576 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system. Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification. Length = 236
 Score = 66.9 bits (164), Expect = 1e-11
 Identities = 49/178 (27%), Positives = 81/178 (45%), Gaps = 11/178 (6%)

Query: 285 LEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFIT-L 343
           LE   ++  Y  R  + D S  +  GE + ++GPNGAGK+TL  LLT       G I+  
Sbjct: 2   LEVAGLSFAYGARRALDDVSFTVRPGEFVALLGPNGAGKSTLFSLLTRLYVAQEGQISVA 61

Query: 344 GTNLK---------IATIDQKREDIDPDKSLASYLTGSSGDSLMVRGESRHVAGYIKDFL 394
           G +L+         +  + Q+   +D D S+   L   +    + R E+R     +   L
Sbjct: 62  GHDLRRAPRAALARLGVVFQQPT-LDLDLSVRQNLRYHAALHGLSRAEARERIAALLARL 120

Query: 395 FHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQL 452
              ++A   ++ L+GG + R  +AR L      L++DEPT  LD  +   +   +  L
Sbjct: 121 GLAERADDKVRELNGGHRRRVEIARALLHRPALLLLDEPTVGLDPASRAAIVAHVRAL 178