RPSBLAST alignment for GI: 254781123 and conserved domain: PRK13652

>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional. Length = 277
 Score = 66.8 bits (163), Expect = 2e-11
 Identities = 49/161 (30%), Positives = 77/161 (47%), Gaps = 30/161 (18%)

Query: 16  GGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVF----------LH 65
           G  + L ++        RI ++G NG+GKSTL +   GI +P SG+V           + 
Sbjct: 15  GSKEALNNINFIAPRNSRIAVIGPNGAGKSTLFRHFNGILKPTSGSVLIRGEPITKENIR 74

Query: 66  SSSR-LGYLEQNPDLSHFS-TISQYI----------DDTIKDTIEAPYSPYSLLKKFNLR 113
              + +G + QNPD   FS T+ Q I          ++T+   +       S L    L 
Sbjct: 75  EVRKFVGLVFQNPDDQIFSPTVEQDIAFGPINLGLDEETVAHRVS------SALHMLGLE 128

Query: 114 E-QDRI-ENLSVGQTRCVALMKMLISRPDILILDEPTNHLD 152
           E +DR+  +LS G+ + VA+  ++   P +L+LDEPT  LD
Sbjct: 129 ELRDRVPHHLSGGEKKRVAIAGVIAMEPQVLVLDEPTAGLD 169