RPSBLAST alignment for GI: 254781123 and conserved domain: PRK14260

>gnl|CDD|172748 PRK14260, PRK14260, phosphate ABC transporter ATP-binding protein; Provisional. Length = 259
 Score = 43.5 bits (102), Expect = 2e-04
 Identities = 48/206 (23%), Positives = 87/206 (42%), Gaps = 33/206 (16%)

Query: 285 LEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLT------GKIKPDC 338
           ++   ++  Y+    ++  S+ I+  +   I+GP+G GK+T +K L       G +K + 
Sbjct: 8   IKVKDLSFYYNTSKAIEGISMDIYRNKVTAIIGPSGCGKSTFIKTLNRISELEGPVKVEG 67

Query: 339 GFITLGTNLKIATIDQKR--------------------EDIDPDKSLASYLTGSSGDSLM 378
                G N+    I+  R                    E++     +++ L  +  D ++
Sbjct: 68  VVDFFGQNIYDPRININRLRRQIGMVFQRPNPFPMSIYENVAYGVRISAKLPQADLDEIV 127

Query: 379 VRGESRHVAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLD 438
              ES      +   +   D+ +     LSGG++ R  +AR LA     L+MDEP + LD
Sbjct: 128 ---ESALKGAALWQEV--KDKLNKSALGLSGGQQQRLCIARALAIKPKVLLMDEPCSALD 182

Query: 439 FETLDFLERTITQLQG--TILIVSHD 462
                 +E  I  L+   TI IV+H+
Sbjct: 183 PIATMKVEELIHSLRSELTIAIVTHN 208