RPSBLAST alignment for GI: 254781123 and conserved domain: PRK14268

>gnl|CDD|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional. Length = 258
 Score = 44.6 bits (105), Expect = 8e-05
 Identities = 51/216 (23%), Positives = 96/216 (44%), Gaps = 34/216 (15%)

Query: 275 QTTQSSGKLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLT--- 331
           +  Q+  +  ++ + +   Y ++  +K+ S++I       ++GP+G GK+T ++ L    
Sbjct: 3   EGVQNVAQPQIKVENLNLWYGEKQALKNVSMQIPKNSVTALIGPSGCGKSTFIRCLNRMN 62

Query: 332 ---------GKI--------KPDCGFITLGTNLKIATIDQKRE----DIDPDKSLASYLT 370
                    GK+        +PD   + L  N  +  + QK       I  + +    + 
Sbjct: 63  DLIKNCRIEGKVSIEGEDIYEPDVDVVELRKN--VGMVFQKPNPFPMSIYDNVAYGPRIH 120

Query: 371 GSSGDSL--MVRGESRHVAGYIKDFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFL 428
           G++   L  +V    R  A + +      D+  S    LSGG++ R  +AR LA     +
Sbjct: 121 GANKKDLDGVVENALRSAALWDET----SDRLKSPALSLSGGQQQRLCIARTLAVKPKII 176

Query: 429 IMDEPTNDLDFETLDFLERTITQLQG--TILIVSHD 462
           + DEPT+ LD  +   +E  I  L+   TI+IV+H+
Sbjct: 177 LFDEPTSALDPISTARIEDLIMNLKKDYTIVIVTHN 212