RPSBLAST alignment for GI: 254781123 and conserved domain: PTZ00265

>gnl|CDD|173501 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional. Length = 1466
 Score = 48.1 bits (114), Expect = 6e-06
 Identities = 30/100 (30%), Positives = 52/100 (52%), Gaps = 6/100 (6%)

Query: 405  KHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQG----TILIVS 460
            K LSGG+K R  +AR L +    L++DE T+ LD  +   +E+TI  ++     TI+ ++
Sbjct: 1357 KSLSGGQKQRIAIARALLREPKILLLDEATSSLDSNSEKLIEKTIVDIKDKADKTIITIA 1416

Query: 461  HDRDFLDRTVTSTIAAQNIEDPNGYWIKYAGGYSDMLVQQ 500
            H    + R  +  I   N  D  G +++  G + ++L  Q
Sbjct: 1417 HRIASIKR--SDKIVVFNNPDRTGSFVQAHGTHEELLSVQ 1454