RPSBLAST alignment for GI: 254781123 and conserved domain: PLN03073

>gnl|CDD|178622 PLN03073, PLN03073, ABC transporter F family; Provisional. Length = 718
 Score =  115 bits (290), Expect = 3e-26
 Identities = 96/355 (27%), Positives = 162/355 (45%), Gaps = 29/355 (8%)

Query: 129 VALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKINSALIFVSHDRRFLETLSTTTV 188
           +AL + L   PD+L+LDEPTNHLD   + W+E  LLK     I VSH R FL T+ T  +
Sbjct: 353 IALARALFIEPDLLLLDEPTNHLDLHAVLWLETYLLKWPKTFIVVSHAREFLNTVVTDIL 412

Query: 189 WLDRGCLHHLDQGFAYFESWKKNILQQEQIRYHNLKKKNEAEKEWL--RYGVTARRKRNV 246
            L    L      +  FE  ++  L+ +Q +     +++ +  +    ++   A+R   V
Sbjct: 413 HLHGQKLVTYKGDYDTFERTREEQLKNQQ-KAFESNERSRSHMQAFIDKFRYNAKRASLV 471

Query: 247 R-RVKELHEIQKQLQ-----EQKKSFHSTIQTHLQTTQSSGKLVLEADKITKQYDDRLVV 300
           + R+K L  +          + K  F +         +    ++  +D         L+ 
Sbjct: 472 QSRIKALDRLGHVDAVVNDPDYKFEFPTP------DDRPGPPIISFSDASFGYPGGPLLF 525

Query: 301 KDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKRED-- 358
           K+ +  I     I +VGPNG GK+T+LKL++G+++P  G +     +++A   Q   D  
Sbjct: 526 KNLNFGIDLDSRIAMVGPNGIGKSTILKLISGELQPSSGTVFRSAKVRMAVFSQHHVDGL 585

Query: 359 ---IDPDKSLASYLTGSSGDSLMVRGESRHVAGYIKDFLFHPDQAHSLMKHLSGGEKMRA 415
               +P   +     G     L     S  V G +         A   M  LSGG+K R 
Sbjct: 586 DLSSNPLLYMMRCFPGVPEQKLRAHLGSFGVTGNL---------ALQPMYTLSGGQKSRV 636

Query: 416 IVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQGTILIVSHDRDFLDRTV 470
             A++  +  + L++DEP+N LD + ++ L + +   QG +L+VSHD   +  +V
Sbjct: 637 AFAKITFKKPHILLLDEPSNHLDLDAVEALIQGLVLFQGGVLMVSHDEHLISGSV 691