RPSBLAST alignment for GI: 254781123 and conserved domain: PLN03073

>gnl|CDD|178622 PLN03073, PLN03073, ABC transporter F family; Provisional. Length = 718
 Score = 40.2 bits (94), Expect = 0.002
 Identities = 16/47 (34%), Positives = 29/47 (61%)

Query: 6   LRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAA 52
           + +++ S ++GG DL+ D  +++       LVG NG+GK+T L+  A
Sbjct: 178 IHMENFSISVGGRDLIVDASVTLAFGRHYGLVGRNGTGKTTFLRYMA 224