RPSBLAST alignment for GI: 254781123 and conserved domain: PRK09473

>gnl|CDD|181888 PRK09473, oppD, oligopeptide transporter ATP-binding component; Provisional. Length = 330
 Score = 39.3 bits (92), Expect = 0.003
 Identities = 60/200 (30%), Positives = 91/200 (45%), Gaps = 47/200 (23%)

Query: 300 VKDFSLRIHYGECIGIVGPNGAGKT----TLLKLLT--GKIKPDCGF----ITLGTNLKI 349
           V D +  +  GE +GIVG +G+GK+     L+ LL   G+I     F    I    NL  
Sbjct: 32  VNDLNFSLRAGETLGIVGESGSGKSQTAFALMGLLAANGRIGGSATFNGREIL---NLPE 88

Query: 350 ATIDQKR-EDI-----DPDKSLASYLTGSSGDSLMV-----RGESRHVA--GYIK--DFL 394
             +++ R E I     DP  SL  Y+    G+ LM      +G S+  A    ++  D +
Sbjct: 89  KELNKLRAEQISMIFQDPMTSLNPYM--RVGEQLMEVLMLHKGMSKAEAFEESVRMLDAV 146

Query: 395 FHPDQAHSLMK----HLSGGEKMRAIVAR-VLAQPFNFLIMDEPTNDLD-------FETL 442
             P +A   MK      SGG + R ++A  +L +P   LI DEPT  LD          L
Sbjct: 147 KMP-EARKRMKMYPHEFSGGMRQRVMIAMALLCRP-KLLIADEPTTALDVTVQAQIMTLL 204

Query: 443 DFLERTITQLQGTILIVSHD 462
           + L+R   +    I++++HD
Sbjct: 205 NELKR---EFNTAIIMITHD 221