RPSBLAST alignment for GI: 254781123 and conserved domain: PRK09544

>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed. Length = 251
 Score = 79.4 bits (196), Expect = 2e-15
 Identities = 54/182 (29%), Positives = 90/182 (49%), Gaps = 16/182 (8%)

Query: 288 DKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNL 347
           + ++  +  R V+ D SL +  G+ + ++GPNGAGK+TL++++ G + PD G I     L
Sbjct: 8   ENVSVSFGQRRVLSDVSLELKPGKILTLLGPNGAGKSTLVRVVLGLVAPDEGVIKRNGKL 67

Query: 348 KIATIDQKREDIDPDKSLASYLTGSSGDSLMVRGESRHVAGYIKDFLFHPDQAHSL---M 404
           +I  + QK   +D    L      +    L +R  ++     I   L      H +   M
Sbjct: 68  RIGYVPQKLY-LDTTLPL------TVNRFLRLRPGTK--KEDILPALKRVQAGHLIDAPM 118

Query: 405 KHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLD----FETLDFLERTITQLQGTILIVS 460
           + LSGGE  R ++AR L      L++DEPT  +D        D +++   +L   +L+VS
Sbjct: 119 QKLSGGETQRVLLARALLNRPQLLVLDEPTQGVDVNGQVALYDLIDQLRRELDCAVLMVS 178

Query: 461 HD 462
           HD
Sbjct: 179 HD 180