RPSBLAST alignment for GI: 254781123 and conserved domain: PRK10575

>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional. Length = 265
 Score = 59.8 bits (145), Expect = 2e-09
 Identities = 58/196 (29%), Positives = 87/196 (44%), Gaps = 40/196 (20%)

Query: 296 DRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQK 355
            R ++   SL    G+  G++G NG+GK+TLLK+L     P  G I L          Q 
Sbjct: 23  GRTLLHPLSLTFPAGKVTGLIGHNGSGKSTLLKMLGRHQPPSEGEILLD--------AQP 74

Query: 356 REDIDPDKSLA---SYLTGS--SGDSLMVR-------------------GESRHVAGYIK 391
            E     K+ A   +YL     + + + VR                    +   V   I 
Sbjct: 75  LESWS-SKAFARKVAYLPQQLPAAEGMTVRELVAIGRYPWHGALGRFGAADREKVEEAIS 133

Query: 392 DFLFHPDQAHSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDF----ETLDFLER 447
                P  AH L+  LSGGE+ RA +A ++AQ    L++DEPT+ LD     + L  + R
Sbjct: 134 LVGLKP-LAHRLVDSLSGGERQRAWIAMLVAQDSRCLLLDEPTSALDIAHQVDVLALVHR 192

Query: 448 TITQLQG-TILIVSHD 462
            ++Q +G T++ V HD
Sbjct: 193 -LSQERGLTVIAVLHD 207