RPSBLAST alignment for GI: 254781123 and conserved domain: PRK10575

>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional. Length = 265
 Score = 47.9 bits (114), Expect = 9e-06
 Identities = 45/178 (25%), Positives = 78/178 (43%), Gaps = 39/178 (21%)

Query: 5   ILRLDHISATIGGIDLLQDVCLSIKPKERIC-LVGCNGSGKSTLLKIAAGITEPQSGNVF 63
              L ++S  + G  LL  + L+  P  ++  L+G NGSGKSTLLK+      P  G + 
Sbjct: 11  TFALRNVSFRVPGRTLLHPLSLTF-PAGKVTGLIGHNGSGKSTLLKMLGRHQPPSEGEIL 69

Query: 64  LHS-----------SSRLGYLEQNPDLSHFSTISQYIDDTIKDTIEAPYSPYSLLKKFNL 112
           L +           + ++ YL Q    +   T+ + +           Y  +  L +F  
Sbjct: 70  LDAQPLESWSSKAFARKVAYLPQQLPAAEGMTVRELV-------AIGRYPWHGALGRFGA 122

Query: 113 REQDRIE-----------------NLSVGQTRCVALMKMLISRPD-ILILDEPTNHLD 152
            +++++E                 +LS G+ R  A + ML+++    L+LDEPT+ LD
Sbjct: 123 ADREKVEEAISLVGLKPLAHRLVDSLSGGE-RQRAWIAMLVAQDSRCLLLDEPTSALD 179