RPSBLAST alignment for GI: 254781123 and conserved domain: PRK10636

>gnl|CDD|182605 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional. Length = 638
 Score =  179 bits (456), Expect = 2e-45
 Identities = 166/637 (26%), Positives = 284/637 (44%), Gaps = 66/637 (10%)

Query: 20  LLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHSSSRLGYLEQNPDL 79
           LL +   +I P +++ LVG NG GKSTLL +         G+     + +L ++ Q    
Sbjct: 16  LLDNATATINPGQKVGLVGKNGCGKSTLLALLKNEISADGGSYTFPGNWQLAWVNQETPA 75

Query: 80  SHFSTISQYID-------------------------------DTIKD-TIEAPYSPYSLL 107
                +   ID                               D I   TI +  +  SLL
Sbjct: 76  LPQPALEYVIDGDREYRQLEAQLHDANERNDGHAIATIHGKLDAIDAWTIRSRAA--SLL 133

Query: 108 KKFNLRE---QDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELL 164
                     +  + + S G    + L + LI R D+L+LDEPTNHLD   + W+E+ L 
Sbjct: 134 HGLGFSNEQLERPVSDFSGGWRMRLNLAQALICRSDLLLLDEPTNHLDLDAVIWLEKWLK 193

Query: 165 KINSALIFVSHDRRFLETLSTTTVWLDRGCLHHLDQGFAYFESWKKNILQQEQIRYHNLK 224
                LI +SHDR FL+ +    + +++  L      ++ FE  +   L Q+Q  Y + +
Sbjct: 194 SYQGTLILISHDRDFLDPIVDKIIHIEQQSLFEYTGNYSSFEVQRATRLAQQQAMYESQQ 253

Query: 225 KKNEAEKEWL-RYGVTARR-KRNVRRVKELHEIQKQLQEQ-KKSFHSTIQTHLQTTQSSG 281
           ++    + ++ R+   A + K+   R+K L  ++          FH +     +  +S  
Sbjct: 254 ERVAHLQSYIDRFRAKATKAKQAQSRIKMLERMELIAPAHVDNPFHFS----FRAPESLP 309

Query: 282 KLVLEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFI 341
             +L+ +K++  Y DR+++    L +  G  IG++G NGAGK+TL+KLL G++ P  G I
Sbjct: 310 NPLLKMEKVSAGYGDRIILDSIKLNLVPGSRIGLLGRNGAGKSTLIKLLAGELAPVSGEI 369

Query: 342 TLGTNLKIATIDQKR-EDIDPDKSLASYLTGSSGDSLMVRGESRHVAGYIKDFLFHPDQA 400
            L   +K+    Q + E +  D+S   +L       L  +   + +  Y+  F F  D+ 
Sbjct: 370 GLAKGIKLGYFAQHQLEFLRADESPLQHLA-----RLAPQELEQKLRDYLGGFGFQGDKV 424

Query: 401 HSLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQLQGTILIVS 460
               +  SGGEK R ++A ++ Q  N L++DEPTN LD +    L   +   +G +++VS
Sbjct: 425 TEETRRFSGGEKARLVLALIVWQRPNLLLLDEPTNHLDLDMRQALTEALIDFEGALVVVS 484

Query: 461 HDRDFLDRTVTST---IAAQNIEDPNGYWIKYAGGYSDMLVQQKKSHPTPQKKNPPAQSL 517
           HDR  L R+ T     +    +E  +G    Y    SD  VQ++++      K   A S 
Sbjct: 485 HDRHLL-RSTTDDLYLVHDGKVEPFDGDLEDYQQWLSD--VQKQENQTDEAPKENNANSA 541

Query: 518 QEETVKKEKKQKRKNRLSYSQKLL--LERLPQEIHKIQLKITEKEQQINDQNLISNEGK- 574
           Q    +K++K++     + +Q L   + RL +E+ K+  ++ + E+++ D  L     K 
Sbjct: 542 QA---RKDQKRREAELRTQTQPLRKEIARLEKEMEKLNAQLAQAEEKLGDSELYDQSRKA 59