RPSBLAST alignment for GI: 254781123 and conserved domain: PRK10790

>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional. Length = 592
 Score = 52.4 bits (126), Expect = 4e-07
 Identities = 55/207 (26%), Positives = 96/207 (46%), Gaps = 34/207 (16%)

Query: 279 SSGKLVLEADKITKQY-DDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPD 337
            SG++  + D ++  Y DD LV+++ +L +     + +VG  G+GK+TL  LL G     
Sbjct: 337 QSGRI--DIDNVSFAYRDDNLVLQNINLSVPSRGFVALVGHTGSGKSTLASLLMGYYPLT 394

Query: 338 CGFITL-GTNLK----------IATIDQKREDIDP----DKSLASYLTGS--SGDSLMVR 380
            G I L G  L           +A + Q     DP    D  LA+   G   S + +   
Sbjct: 395 EGEIRLDGRPLSSLSHSVLRQGVAMVQQ-----DPVVLADTFLANVTLGRDISEEQVWQA 449

Query: 381 GESRHVAGYIKDFLFHPDQAHSLM----KHLSGGEKMRAIVARVLAQPFNFLIMDEPTND 436
            E+  +A   +     PD  ++ +     +LS G+K    +ARVL Q    LI+DE T +
Sbjct: 450 LETVQLAELARSL---PDGLYTPLGEQGNNLSVGQKQLLALARVLVQTPQILILDEATAN 506

Query: 437 LDFETLDFLERTITQL--QGTILIVSH 461
           +D  T   +++ +  +    T+++++H
Sbjct: 507 IDSGTEQAIQQALAAVREHTTLVVIAH 533