RPSBLAST alignment for GI: 254781123 and conserved domain: PRK10851

>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional. Length = 353
 Score = 68.2 bits (167), Expect = 5e-12
 Identities = 65/202 (32%), Positives = 97/202 (48%), Gaps = 30/202 (14%)

Query: 1   MSLPILRLDHISATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSG 60
           MS+ I    +I  + G   +L D+ L I   + + L+G +GSGK+TLL+I AG+    SG
Sbjct: 1   MSIEI---ANIKKSFGRTQVLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGLEHQTSG 57

Query: 61  NVFLHSS--SRL-------GYLEQNPDLSHFSTISQYI--DDTIKDTIEAPYSPYSLLKK 109
           ++  H +  SRL       G++ Q+  L    T+   I    T+    E P +     K 
Sbjct: 58  HIRFHGTDVSRLHARDRKVGFVFQHYALFRHMTVFDNIAFGLTVLPRRERPNAAAIKAKV 117

Query: 110 FNLREQDRIEN--------LSVGQTRCVALMKMLISRPDILILDEPTNHLDFRT----IH 157
             L E  ++ +        LS GQ + VAL + L   P IL+LDEP   LD +       
Sbjct: 118 TQLLEMVQLAHLADRYPAQLSGGQKQRVALARALAVEPQILLLDEPFGALDAQVRKELRR 177

Query: 158 WMEQ--ELLKINSALIFVSHDR 177
           W+ Q  E LK  S  +FV+HD+
Sbjct: 178 WLRQLHEELKFTS--VFVTHDQ 197