RPSBLAST alignment for GI: 254781123 and conserved domain: PRK10908

>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional. Length = 222
 Score = 69.5 bits (170), Expect = 2e-12
 Identities = 61/218 (27%), Positives = 101/218 (46%), Gaps = 28/218 (12%)

Query: 5   ILRLDHIS-ATIGGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVF 63
           ++R +H+S A +GG   LQ V   ++P E   L G +G+GKSTLLK+  GI  P +G ++
Sbjct: 1   MIRFEHVSKAYLGGRQALQGVTFHMRPGEMAFLTGHSGAGKSTLLKLICGIERPSAGKIW 60

Query: 64  L--HSSSRLGYLEQNPDLSHFSTISQ----YIDDTIKDTIEAPY------------SPYS 105
              H  +RL   E          I Q     +D T+ D +  P                +
Sbjct: 61  FSGHDITRLKNREVPFLRRQIGMIFQDHHLLMDRTVYDNVAIPLIIAGASGDDIRRRVSA 120

Query: 106 LLKKFNLREQDRIEN----LSVGQTRCVALMKMLISRPDILILDEPTNHLD---FRTIHW 158
            L K  L   D+ +N    LS G+ + V + + ++++P +L+ DEPT +LD      I  
Sbjct: 121 ALDKVGL--LDKAKNFPIQLSGGEQQRVGIARAVVNKPAVLLADEPTGNLDDALSEGILR 178

Query: 159 MEQELLKINSALIFVSHDRRFLETLSTTTVWLDRGCLH 196
           + +E  ++   ++  +HD   +   S   + L  G LH
Sbjct: 179 LFEEFNRVGVTVLMATHDIGLISRRSYRMLTLSDGHLH 216