RPSBLAST alignment for GI: 254781123 and conserved domain: PRK10938

>gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional. Length = 490
 Score = 49.6 bits (119), Expect = 2e-06
 Identities = 21/40 (52%), Positives = 30/40 (75%)

Query: 293 QYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTG 332
            Y+DR ++ + S +++ GE   IVGPNGAGK+TLL L+TG
Sbjct: 269 SYNDRPILHNLSWQVNPGEHWQIVGPNGAGKSTLLSLITG 308