RPSBLAST alignment for GI: 254781123 and conserved domain: PRK11153

>gnl|CDD|183001 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional. Length = 343
 Score = 44.8 bits (107), Expect = 7e-05
 Identities = 53/182 (29%), Positives = 79/182 (43%), Gaps = 34/182 (18%)

Query: 16  GGIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLH-------SSS 68
             I  L +V L I   E   ++G +G+GKSTL++    +  P SG V +        S  
Sbjct: 16  RTIHALNNVSLHIPAGEIFGVIGASGAGKSTLIRCINLLERPTSGRVLVDGQDLTALSEK 75

Query: 69  RL-------GYLEQNPDLSHFSTISQY-----------IDDTIKDTIEAPYSPYSLLKKF 110
            L       G + Q     HF+ +S             +  T K  I+A  +   LL+  
Sbjct: 76  ELRKARRQIGMIFQ-----HFNLLSSRTVFDNVALPLELAGTPKAEIKARVTE--LLELV 128

Query: 111 NLREQ-DRI-ENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKINS 168
            L ++ DR    LS GQ + VA+ + L S P +L+ DE T+ LD  T   + + L  IN 
Sbjct: 129 GLSDKADRYPAQLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINR 188

Query: 169 AL 170
            L
Sbjct: 189 EL 190