RPSBLAST alignment for GI: 254781123 and conserved domain: PRK11174

>gnl|CDD|183014 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed. Length = 588
 Score = 57.9 bits (141), Expect = 8e-09
 Identities = 60/251 (23%), Positives = 98/251 (39%), Gaps = 50/251 (19%)

Query: 17  GIDLLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGN-----VFLHSSS--- 68
           G  L   +  ++   +RI LVG +G+GK++LL    G   P  G+     + L       
Sbjct: 362 GKTLAGPLNFTLPAGQRIALVGPSGAGKTSLLNALLGFL-PYQGSLKINGIELRELDPES 420

Query: 69  ---RLGYLEQNPDLSHFSTISQYI--------DDTIKDTIEAPYSP---YSLLKKFNLRE 114
               L ++ QNP L H  T+   +        D+ ++  +E  +       L +  +   
Sbjct: 421 WRKHLSWVGQNPQLPH-GTLRDNVLLGNPDASDEQLQQALENAWVSEFLPLLPQGLDTPI 479

Query: 115 QDRIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKINSALIFVS 174
            D+   LSVGQ + +AL + L+    +L+LDEPT  LD  +    EQ    +  AL   S
Sbjct: 480 GDQAAGLSVGQAQRLALARALLQPCQLLLLDEPTASLDAHS----EQ---LVMQALNAAS 532

Query: 175 HDRRFLETLSTTTVWLDRGCLHHLDQGFAYFESWKKNILQQEQI----RYHNLKKKNEAE 230
             +    TL  T         H L+    + + W   ++Q  QI     Y  L +     
Sbjct: 533 RRQ---TTLMVT---------HQLEDLAQWDQIW---VMQDGQIVQQGDYAELSQAGGLF 577

Query: 231 KEWLRYGVTAR 241
              L +     
Sbjct: 578 ATLLAHRQEEI 588