RPSBLAST alignment for GI: 254781123 and conserved domain: PRK11247

>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional. Length = 257
 Score = 78.6 bits (194), Expect = 5e-15
 Identities = 59/185 (31%), Positives = 89/185 (48%), Gaps = 11/185 (5%)

Query: 285 LEADKITKQYDDRLVVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLG 344
           L  + ++K+Y +R V+    L I  G+ + +VG +G GK+TLL+LL G   P  G +  G
Sbjct: 13  LLLNAVSKRYGERTVLNQLDLHIPAGQFVAVVGRSGCGKSTLLRLLAGLETPSAGELLAG 72

Query: 345 TNLKIATIDQKREDID---PDKSLASYLTGSSGDSLMVRGESRHVAGYIKDFLFHPDQAH 401
           T    A + + RED      D  L  +        L ++G+ R  A      +   D+A+
Sbjct: 73  T----APLAEAREDTRLMFQDARLLPWKKVIDNVGLGLKGQWRDAALQALAAVGLADRAN 128

Query: 402 SLMKHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLD----FETLDFLERTITQLQGTIL 457
                LSGG+K R  +AR L      L++DEP   LD     E  D +E    Q   T+L
Sbjct: 129 EWPAALSGGQKQRVALARALIHRPGLLLLDEPLGALDALTRIEMQDLIESLWQQHGFTVL 188

Query: 458 IVSHD 462
           +V+HD
Sbjct: 189 LVTHD 193